KEGG   Nitrosomonas europaea: NE1003Help
Entry
NE1003            CDS       T00130                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
neu  Nitrosomonas europaea
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1003
Enzymes [BR:neu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NE1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1092047..1092952
Genome map
AA seq 301 aa AA seqDB search
MNIEQLNKNYKIGEQVVFAEGEGGLPFIHVRNDKASALISVYAGQVLAYRPQSIQDDLLF
LSKRAYYQAGKAIKGGVPICWPWFGPDPEGRGRPAHGFMRNCMWDIVEVSATPEGNTRIV
LGSTDTEETQSIWSRSFVLRLEITIGDTLNLELVTRNSGSQACTVTQAFHTYFSVGDIRQ
THVSGLENTRYIDKVDDNLEKNQTGSVTIDAEVDRIYQSVGSNLVIHDTARKRRIHITSK
GNRTAVVWNPWAKISAEMADLEDDDYLRFICVETTNAATDRVHIQPGSEFRLIANYRIEQ
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaacaattaaacaaaaattacaaaattggggaacaggtagtttttgcagag
ggtgaaggaggtttgccctttattcatgtcaggaatgacaaagccagcgcgctgatctcg
gtttatgccgggcaggtacttgcataccggcctcagagtattcaggacgatcttctgttc
ctgagcaagcgcgcctattatcaggcgggcaaggcgatcaagggaggcgtgccaatctgc
tggccgtggttcggtccggacccggaaggcagaggacgtcccgcacatggcttcatgcgt
aactgcatgtgggatatcgtcgaagtatccgcaacaccggaaggcaatactcgcatcgta
ctgggatcgacagataccgaagaaacacaatccatctggtcccgctcattcgtactgcgg
ctggaaatcactatcggcgatacgctcaatcttgaactggtaacccgcaattccggttca
caggcgtgcaccgtcacccaggcttttcatacctatttcagcgtgggagatattcgccag
acccatgtatccggtctggaaaatacccgctatatcgacaaagtggacgataacctggaa
aaaaaccaaactggatcggtgactatcgatgcggaagtggatcgaatctaccagtcggtt
ggcagcaatctcgtcattcatgatactgcccgcaagcgccgtatccacattacttccaaa
ggtaaccgaacagcagtggtatggaacccctgggcaaaaatttcggctgaaatggcagat
ctggaagacgatgattacctgcgtttcatttgtgtggagaccaccaacgctgcaacagac
cgggtacatatccagcccggcagcgaattccggctgattgccaattaccggatcgagcag
gattga

DBGET integrated database retrieval system