KEGG   Nitrosomonas europaea: NE1047Help
Entry
NE1047            CDS       T00130                                 

Gene name
sdhD
Definition
succinate dehydrogenase, cytochrome b subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
neu  Nitrosomonas europaea
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE1047 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE1047 (sdhD)
   00650 Butanoate metabolism
    NE1047 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NE1047 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1133785..1134138
Genome map
AA seq 117 aa AA seqDB search
MVKPVHRVVTGAHYGLKDWLVQRITAVLMAAYTGLLIILITVYQPESHEEFKALFSIQWM
KIASLLFFAGLCWHAWVGVRNVLMDYVHPMPVRLTLQITCIVALLGYLIWFLDILWG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaccggttcatcgtgtcgtaaccggagcgcattacggtctgaaagactggttg
gtgcagcgtatcactgctgttctgatggcagcctataccgggttgctgatcatactcata
acagtttatcaaccggaaagccatgaagagttcaaagcattattctccattcagtggatg
aaaattgcttcgttacttttttttgccggcttatgttggcacgcttgggtaggtgtacgt
aatgtcctgatggattatgtccatccgatgcctgtccgcctgacactgcaaataacatgt
atcgttgcattactgggttacctgatatggttcctggatattctgtggggctga

DBGET integrated database retrieval system