KEGG   Nitrosomonas europaea: NE1127Help
Entry
NE1127            CDS       T00130                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
neu  Nitrosomonas europaea
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NE1127 (asnB)
Enzymes [BR:neu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NE1127 (asnB)
Peptidases [BR:neu01002]
 Cysteine Peptidases
  Family C44
   NE1127 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1223233..1225092
Genome map
AA seq 619 aa AA seqDB search
MSGICGWLGADHLAIENQQIIDRMTGSLIRFDSNPVQTAVQGNAALSVAAKTSHSHLYEK
EGLLVGIWGRIKSRNTDLQTAIDARGMAAALADQWKQKGRQAFSELAGEFVCCIVDSHAR
EVALAIDPLGTHVLYYQSLGDDGILFGTSADALLTHPRANTEINPQGLLNYLYFHMIPGP
DTIYLAQKRLLPGEYLHFHDGHTEIGRYTQIRFDEDIKRPFPELQQEFLSLLRKSVSEAV
QGQKAGTFLSGGTDSSTLAGILTEVTGEPAKTYSIGFEATGYDEMHYARIAARHFATDHH
EYYVTPDDVVETIPLIASVFDQPFGNASALPAYYCGRMARNDGLDLLLGGDGGDELFGGN
VRYAKQYIFSLYDKIPAPLRNYLLSPFILSLPENKGPKLLRKARSYVAQATVPMPHRMET
YNLLAHYGFETVFSPELLAKIDTAQPALLIERTYQDVSHARSLINRMLAFDWKFTLADND
FPKVVQACHLAGMEVAFPFVNDEILAFSLALPPEQKLKGTQLRYFFKQALRGFLPDEIIT
KQKQGFGLPFGVWLQTHRPLREIAADSLSDLKSRNIIRTDFIDQLLDQHLHEHASYHGTM
VWLLMMLEYWFKQHHPIKV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatatgtggctggctgggagcagatcacctggcaatcgaaaatcagcagatc
attgatcgcatgaccggttcgctgattcgttttgacagcaatcctgtgcagacagcggta
cagggcaatgccgctctttccgtcgccgcaaaaacaagccattcgcatctgtatgaaaaa
gaaggcttactggtagggatctggggaaggataaaatcccggaatacagatctgcagaca
gccatcgatgccagaggaatggcagcggcacttgcagatcagtggaagcagaaaggcagg
caagccttctccgagctcgctggtgaattcgtttgctgcatcgtggacagccatgcacgt
gaagttgctctggccatcgatccactgggtacacacgtactttattaccagtcgctgggt
gacgacggaattttatttggcacttctgccgatgccctgctcacccatccccgggccaat
actgaaatcaatccgcaagggctgctcaactacctttactttcacatgataccggggccg
gataccatctatctggcccagaagcgcctgcttcctggtgagtatctgcatttccacgat
ggccacacggaaatcggccgttatacgcaaatccggtttgatgaagatataaaacgcccc
ttccccgagcttcaacaggaatttctctccctgctcagaaaaagtgtcagtgaagcggta
cagggtcagaaagcaggtacatttctgagcggggggacagacagttccactctggcaggg
atattgacagaagtcacgggtgaacccgccaaaacctattcaatcggctttgaagccacc
ggctacgatgaaatgcattacgcacgtattgccgcccggcatttcgcgaccgatcaccat
gagtactatgtcacaccagacgatgtcgtagaaacgatcccgttgattgcttcggtcttc
gatcaaccttttggtaatgcatcggcgcttccggcttattactgcgggcgcatggccaga
aatgacggactcgacttgctactcggtggcgatgggggtgatgagctgttcggtggtaat
gtacgttacgcaaaacaatatattttttcactttacgacaaaatcccggcacccctgaga
aattacctgctttccccctttattttgtctcttccagagaacaaaggacccaaactgctg
cgcaaggcgcgaagctatgtcgcacaggcaacggttcccatgcctcatcgcatggagact
tataatctgctggcacattatgggtttgaaactgtattttcaccggaattactggcaaag
atcgatacagcgcaacccgctttgctgattgaacgaacctatcaggatgtgtctcatgca
cgcagcctgatcaaccgcatgcttgccttcgactggaaattcacactggcagacaatgat
ttcccaaaagttgtccaggcctgtcatctggccggcatggaagtggctttcccgtttgtt
aatgatgaaatactcgctttttctctcgcgcttcctcctgaacagaaattgaaaggaacg
cagttgcgttatttctttaaacaggcgttacgtggttttttaccggatgagatcattacc
aaacaaaaacaggggtttggcttgccgttcggtgtctggctccagacacacagacctttg
cgggaaattgctgcagacagtctgagtgacctcaaatcacgcaacatcatacgcaccgat
ttcatcgaccagctgcttgatcagcatcttcatgaacatgccagttatcacggcacgatg
gtatggctgctgatgatgctggaatattggttcaaacagcatcacccgataaaagtttaa

DBGET integrated database retrieval system