KEGG   Nitrosomonas europaea: NE1147Help
Entry
NE1147            CDS       T00130                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
neu  Nitrosomonas europaea
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:neu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1244008..1244979)
Genome map
AA seq 323 aa AA seqDB search
MSDDDQIRIDGAIARKTPYGMLREPTFSGMLSFMRCNFRKDLTGAELVISGIPLDLAVSY
RSGARFGPLGIRQASAEVASLKPYPWGFDPFEHLAVIDSGDCFLDVHNPLTIHGAIVDHA
RHILASGARMLTFGGDHSISYPLLQAHVEKTGAPLSLIHFDAHCDTWPDDSLASLNHGSM
FYKAVREGLIDVKRSVQIGIRTWNDDFMGINILDADRIHRQGTDAVVAEIERIVGTQPAY
LTFDIDCLDPAYAPGTGTPVCGGLSTAQALAIIRGLTAINLIGMDIVEVSPPYDHSQITA
LAAAHIACDLICLLAKRKADGLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgatgatcagatcagaatcgatggtgcgatagcgcgtaaaacaccttatggc
atgctgcgtgaaccgaccttctcgggcatgctttcttttatgcgctgcaatttccgcaaa
gacctgacgggtgccgaactggtaatcagtggtattccactggatctggcggtgtcttat
cgttccggtgcacgttttggcccgctggggattcgtcaggcttctgccgaagttgcttcg
ttaaagccttatccgtggggattcgatccattcgaacatcttgccgtgatcgattctggc
gattgttttctcgacgtgcataacccgctgacgatccatggtgcgattgttgaccatgca
cggcatattctggcctctggcgcacgtatgctgacattcggcggtgatcactcgatttcc
tatccgttgctgcaggcgcatgtggaaaagacaggtgctccgctgtcgttgattcacttc
gatgcgcattgtgatacctggccggatgattcactcgcttcactgaaccatggctccatg
ttttacaaagcggtgcgggagggtctgatcgacgtcaaacgttccgttcagatcggtatt
cgcacctggaatgatgatttcatggggatcaatattctggatgccgatcggatacaccgg
cagggcacggatgcggtcgttgcagaaatcgagcgcatcgtcggaactcaaccggcatat
cttacttttgatatcgactgccttgatccagcctatgcgccaggtaccggtacgccggtt
tgtggaggattgtctactgctcaggcactggcaatcattcgtggtcttacggcaatcaac
ctgattggcatggatatcgtagaagtatcgcctccctatgatcacagccagataacggcg
cttgcggcagcccatatcgcctgtgatctgatctgtctgctggcaaagcgcaaggctgac
gggctgttatag

DBGET integrated database retrieval system