KEGG   Nitrosomonas europaea: NE1170Help
Entry
NE1170            CDS       T00130                                 

Gene name
dfrA
Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
neu  Nitrosomonas europaea
Brite
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     NE1170 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1270057..1271103)
Genome map
AA seq 348 aa AA seqDB search
MPASRGCSLVTGGGGFIGTHLVRLLLEQGERVRVLELDDVPVLDGAEVIRGSVADEAVVH
RAVKGVRRVYHLAAHTDLWAPDKRIFRQINYESTRTVLREAMYADVEVVVHTSTEAILTG
RGDPDQSDRTLSSSSRKRKTLGPYCQAKLMAEQAALEASRNGLSVVVVSPTLPVGPGDRH
ITPPTRMIVDFLNRKIPAYLDCRLNLVDVRDVAEGHILAAQRGRSGERYLLGHENIMLSR
LLLMLKEITGVVMPEHKIPYWLALVVGILQEFVADHVTHKAPMAPLTGVRLAGRGNDFDS
DKAVRELGFRQTPIRQALIDEIIWLVETGHINLPVHSFRKHFGSTEKK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccggccagccggggttgctccctggtgaccggtggtggtggatttatcggtacccat
ctcgtgcggttgctgctggagcagggggagcgggtaagagtgctcgaactggatgatgta
cccgttctggatggagccgaggtcattcgtggttcggttgcggatgaagcagtggtacac
cgggcagtgaaaggtgtccgcagggtttatcatctggccgcccatactgacttatgggca
cccgataaacggatattccggcagatcaattacgaaagtactcgtaccgtgttgcgtgag
gcgatgtatgcggatgtcgaggtagtagtgcatacctcgacagaagccatactgaccggg
cggggtgatccggaccaatcagatcgcacactgtcatcttcatcccgcaaaaggaaaact
ttggggccgtattgccaggccaagctgatggcggaacaggctgcactggaagcttccaga
aatggtttgtcagtcgtcgttgtctcaccaacgttgccggtgggtccgggagatcggcat
attactccgcctacgcgtatgatcgtggatttcctgaaccgcaaaattcctgcttatctc
gattgtcgtttgaatctggtcgacgtccgggacgtggcagaagggcatatcctggctgct
cagcgaggacgttccggagaacgctacctgcttggtcatgagaacataatgttgagccgg
ttgctactcatgcttaaggaaatcaccggtgtggtgatgcctgaacataagattccgtac
tggttggctctggtggtggggatattgcaggagttcgtggctgatcatgtgacacacaaa
gctcccatggcaccactgacgggggtgcgtctggccgggcgagggaatgattttgacagt
gacaaggccgtgcgtgaactcggcttcaggcaaaccccgattcggcaggcgctgatcgat
gaaattatctggctggtcgagacggggcatatcaatctgcctgttcattcattcaggaaa
cattttggatctacagaaaagaaatag

DBGET integrated database retrieval system