KEGG   Nitrosomonas europaea: NE1241Help
Entry
NE1241            CDS       T00130                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
neu  Nitrosomonas europaea
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NE1241
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NE1241
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     NE1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1357006..1358508)
Genome map
AA seq 500 aa AA seqDB search
MAIRKDANTLTAAERAEFVAAIRVLKAEGIYDRFVLRHANANMSAIHRCSAFLPWHRRFI
YDLELELQRVSGNPNLGIPYWNWPSGSANASMWNDDLLGGNGDAGGVVRTGPFRSGQWTV
INSSGLPAGPLMRAFGQNGLPTLPTQAAINQVMAVTPYDTSPWNMNSNPSFRNQLEGWIG
PNLHNRGHVWVGGSMLPMTSPNDPVFFMHHCMVDKIWHEWQLRFPNQGYLPASGGPFGQN
LTDPMGSTPSGQVGSRPIDVLDSAALGIVYDDAAPQPQPQPEIPLIVVGADPIAAAIGVP
GETDVFRFEVPAFGAHTMYTLGSSDTFMTLFGPNDPNFEVASDDDAGEGFNAQINRNLSA
GTYFLRVRLYSPNSTGNYAVGVRAVSATPGPGPGPVPIPELIVNGVGIDASISAANESDV
YRFNVTTGDFYTIQTNGTTDTFMSLHGPNSQIPEIASNDDSGISFNALIRRQLSPGEYFV
RVRHYSPSGTGAYSVRVTQG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagaaaagatgcaaatacactgactgctgcagaacgggcagaattcgttgct
gccattcgcgtgttgaaggccgaaggcatctatgatcgattcgtgctcagacatgcgaac
gccaatatgagtgcaattcaccgatgctctgcttttttgccgtggcaccgccgctttatt
tatgatctcgaactggaactgcagcgcgtttcgggtaacccgaatctcgggataccttac
tggaactggccatcaggtagcgccaatgcctccatgtggaatgatgatttgctgggtggc
aatggagatgccggtggtgttgtccgtaccggtccattccgctccgggcaatggactgtc
atcaattccagcggattgccagcaggtccgctgatgcgcgctttcggtcagaacggcttg
ccaaccttacccacacaagcggcaatcaatcaagtcatggccgttacgccctatgataca
tcgccgtggaacatgaacagcaatccaagtttccgtaatcagctggaaggctggattggc
cccaatctgcacaaccgtggtcatgtctgggtgggggggtccatgctgccgatgacttcc
ccgaatgatccggtgtttttcatgcaccattgtatggtggataaaatctggcatgaatgg
caactgcgcttcccgaatcaaggttatttaccagccagtggcggcccttttggtcaaaat
ctgactgatccaatgggtagtaccccttcaggacaggtcgggtcgcgtcctatcgatgtg
ctggacagtgcagcgctgggtatcgtatatgatgatgctgctcctcagccgcaacctcag
ccggaaataccgctcattgtcgttggagccgatccgatagcagctgctatcggcgtgccg
ggagaaaccgatgttttccgtttcgaagtcccggccttcggtgctcatacgatgtatacc
ctcggatcatccgatacgttcatgactctgttcggccccaatgatccgaattttgaagtg
gcatcagatgatgatgcaggcgagggtttcaatgcacaaatcaaccgcaatctgtctgca
ggtacttattttctgcgcgttcgtctgtacagcccgaacagtacgggaaattatgcggtt
ggcgtgcgcgcagtcagtgccactccaggccctggtcccggcccggttccgatccccgag
ctcatcgtgaatggtgtgggcatcgatgcatcgatttctgcagcgaatgaaagcgatgtg
taccggtttaatgttactacgggagatttttataccatccagacgaatgggacaacggat
accttcatgagcttgcatggcccgaacagccagataccggaaatcgccagcaacgatgat
tcaggcatctccttcaacgcgctgatccgccgtcaactttctccgggtgaatatttcgtt
cgtgtaagacactactcgccatccgggacaggtgcttattctgttcgggtgacgcaggga
tga

DBGET integrated database retrieval system