KEGG   Nitrosomonas europaea: NE1315Help
Entry
NE1315            CDS       T00130                                 

Gene name
ccp
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
neu  Nitrosomonas europaea
Brite
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NE1315 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1434927..1435931)
Genome map
AA seq 334 aa AA seqDB search
MIKRTLTVSLLSLSLGAMFASAGVMAANEPIQPIKAVTPENADMAELGKMLFFDPRLSKS
GFISCNSCHNLSMGGTDNITTSIGHKWQQGPINAPTVLNSSMNLAQFWDGRAKDLKEQAA
GPIANPKEMASTHEIAEKVVASMPQYRERFKKVFGSDEVTIDRITTAIAQFEETLVTPGS
KFDKWLEGDKNALNQDELEGYNLFKGSGCVQCHNGPAVGGSSYQKMGVFKPYETKNPAAG
RMDVTGNEADRNVFKVPTLRNIELTYPYFHDGGAATLEQAVETMGRIQLNREFNKDEVSK
IVAFLKTLTGDQPDFKLPILPPSNNDTPRSQPYE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcgtacactgactgtttcgctgctgtcattaagtctgggggcgatgtttgcg
tctgccggtgtaatggctgccaatgaaccgatacaaccgattaaggcggtgactccggag
aatgccgatatggcagagctggggaaaatgctgttttttgaccccagactttccaaatcg
gggttcatttcctgcaattcctgtcataacctgagcatgggcggaaccgataatattacc
acctcgatcgggcacaaatggcagcaaggcccgatcaatgctccgactgtcctgaattcc
agcatgaatctggcgcaattctgggatggcagagccaaagacctgaaagaacaggctgcc
ggcccgattgccaacccgaaggaaatggcctctacccatgagatagcagaaaaagtggtc
gcttccatgcctcaatatcgtgagcgattcaagaaagtctttggttccgatgaagtgacg
atcgatcgcatcaccaccgcaattgcccaatttgaagaaacgctggtgacaccgggttca
aaattcgacaaatggctggaaggcgataaaaacgcactgaatcaggatgagctggaaggc
tacaacctgttcaagggcagcggttgcgtgcaatgtcataatggaccagccgtgggtgga
agttcttatcagaaaatgggtgtttttaaaccctatgagaccaaaaacccggccgcgggg
cggatggatgtgaccggcaatgaagctgatcgtaatgtattcaaagtgccaacgttgaga
aatatcgagctgacctacccctattttcatgatggaggggccgcaacgctggaacaggca
gtggagaccatgggaagaatccaattgaaccgtgagttcaacaaggatgaagtttccaaa
atcgttgctttcctgaaaaccctgaccggcgatcagcctgacttcaagttgccgattctg
ccaccttccaataacgatacaccacgttctcagccgtatgagtga

DBGET integrated database retrieval system