KEGG   Nitrosomonas europaea: NE1382Help
Entry
NE1382            CDS       T00130                                 

Gene name
galU1
Definition
ADP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
neu  Nitrosomonas europaea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NE1382 (galU1)
   00052 Galactose metabolism
    NE1382 (galU1)
   00500 Starch and sucrose metabolism
    NE1382 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    NE1382 (galU1)
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NE1382 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1503153..1503857)
Genome map
AA seq 234 aa AA seqDB search
MKIILIKAYELESELERRGKTEMLQYVRNLLPDDMKCVYIRQSEALGLGHAVLCAQPAVG
DEPFAVLLADDLLEGDPVVIRQMVDVYEYYKCSVLGVQQVPREDTRSYGIVASQPIRDDL
EAVQFIVEKPDPEEAPSTMAVVGRYVLTPRIFHHLIRLGKGTGSEIQLTDGIAALMQEEQ
VLAYRYKGQRYDCGSKIGYLEATLAMARKHPEVGAQFEQLLQSFQHQGNSEERQ
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcattttgataaaggcgtatgagctggaatccgagctggagcgccggggaaaa
accgagatgctgcagtacgtgcgcaatctgttgcccgacgatatgaagtgtgtgtatatc
cgccagtctgaagcactgggtctgggccacgcggtgctatgcgcccagccggcggtgggt
gatgaaccttttgctgtgttactggctgacgatttacttgaaggtgaccctgtcgtgata
cgccagatggtggatgtgtacgagtactacaagtgctcggtgctgggtgtgcagcaggtg
ccgcgtgaagatacgcgcagctatggcatagtggccagccagccgattcgtgatgatctg
gaagcagtacagttcattgtggaaaaacctgatccggaagaggctccttccaccatggca
gtggttggacgttatgtactcaccccgcgcattttccatcacctgatacggttgggcaaa
ggcaccgggagcgagatacagttgaccgacggtattgctgcgttgatgcaggaagagcag
gtgctggcctatcgttacaaaggccagcgttacgactgtggcagcaagataggctatttg
gaagccaccttggctatggcgcgtaagcaccctgaagtgggggcgcagtttgaacagctg
ttacagtcgtttcagcaccagggaaactctgaagaacgtcagtga

DBGET integrated database retrieval system