KEGG   Nitrosomonas europaea: NE1383Help
Entry
NE1383            CDS       T00130                                 

Gene name
galU1
Definition
UTP--glucose-1-phosphate uridylyltransferase protein (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
neu  Nitrosomonas europaea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NE1383 (galU1)
   00052 Galactose metabolism
    NE1383 (galU1)
   00500 Starch and sucrose metabolism
    NE1383 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    NE1383 (galU1)
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NE1383 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1503829..1504044)
Genome map
AA seq 71 aa AA seqDB search
MKIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAWAAGITEMIFVTGRSK
RSIEDHFDKGV
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtaaagcggtttttccggtggcggggctgggtactcgttttttaccagcc
accaaggccagccccaaggagatgctgccggtggtggataagccactcatacaatatgct
gtggaagaagcctgggctgctggtattaccgaaatgatattcgtcacgggtcgcagcaag
cgcagcattgaagatcattttgataaaggcgtatga

DBGET integrated database retrieval system