KEGG   Nitrosomonas europaea: NE1455Help
Entry
NE1455            CDS       T00130                                 

Definition
GDSL lipolytic enzyme (EC:3.1.-.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
neu  Nitrosomonas europaea
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NE1455
Enzymes [BR:neu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NE1455
   3.1.2  Thioester hydrolases
    3.1.2.-  
     NE1455
Lipid biosynthesis proteins [BR:neu01004]
 Fatty acid synthase
  Component type
   NE1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1588323..1589009
Genome map
AA seq 228 aa AA seqDB search
MKKLLFVILCLFSIFSLSSAWSGTGTSIIVLGDSLSAGYGLPPGTGWVNLLERRLQNQSP
DYRVINVSISGEITLGGRNRIEQALNDHVPDIVIVALGANDGLQGRSITSIYENLEAIIL
ACKRYNATPLLVGMQLPPNYGISYTQKFRDIYPRLARDQQLQLAPFLMEGFGDQPESFQA
DGIHPTIQAQEKMLDNVWPALTAVLKSVRAPVASEESADKTSTEAILP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctgttcgtcatattatgtttgtttagtatcttctcactcagttcagcc
tggtctggaacaggcaccagtatcatagtgctgggcgacagcctgtccgcaggatatggc
ctgccaccgggaaccggatgggtgaatctgcttgagcggcgattacaaaaccagtctccc
gattacagagtaataaacgtcagcatcagcggggaaattaccttgggcgggcgcaaccgg
attgaacaggcactcaacgaccatgtgccggatatcgttatcgttgcactgggggcaaat
gacggtctgcaaggtcgatcgatcacctccatttatgaaaatctggaagcaatcattctg
gcctgcaaacggtacaatgccactccattactggtcggcatgcaactgccgcccaattat
ggcataagttatacgcaaaagtttcgtgatatctatccacgcttggcacgggatcaacaa
ttacagctggctccattcctgatggaaggttttggcgatcagcccgaatccttccaggcc
gatggaatccatcccactatccaggctcaggaaaaaatgctggataatgtctggccggca
ttgactgctgtgctgaaatcagtccgagcacccgtcgccagcgaagaatcagccgataaa
accagtacagaagcaatcctgccatga

DBGET integrated database retrieval system