KEGG   Nitrosomonas europaea: NE1467Help
Entry
NE1467            CDS       T00130                                 

Definition
Fatty acid desaturase, type 2:Fatty acid desaturase, type 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
neu  Nitrosomonas europaea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:neu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:neu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1600138..1601334)
Genome map
AA seq 398 aa AA seqDB search
MDDIASILMNGLIDLPWWGYIVVALVFTHITIASITIFLHRYQAHRSLELHPIPSHFFRF
WLWLTTGMVTKEWAAVHRKHHAKCETVDDPHSPQVFGIKKVLGEGAELYKVETKNQETLD
RYGHGTPDDWIERNVYTKHSVAGIASMLIINVILFGPLGLTIWAVQMMWTPVMAAGVING
IGHYWGYRNFRSEDASRNIVPWGILIGGEELHNNHHAYPTSARLSNKWYEFDIGWMYIRI
LEMMGLARVKKIAPKLQLNKAKTECDLETLQAVISHRYEILAKYTKSLKIALKNELVHLQ
QAAIENGVDGLTLRNWVLADAKTLKEEERTKLETVLSHAQKLDKLYRMREELSLIWERSA
ATKDELLKQLEDWCRRAEESGIELLEKFSRRLRCYAMA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgcatcaatattgatgaatggactcattgatctgccctggtggggctat
attgttgtggcgctggtatttacccacataacgattgccagtatcaccatttttctgcat
cgttatcaggcacatcggtcacttgagttacaccctatacccagtcatttctttcgtttc
tggctgtggctgacaaccggcatggtaaccaaggaatgggcagcagttcaccggaaacat
catgcaaaatgtgaaaccgtggatgatcctcacagcccacaggtctttggtataaaaaag
gtattgggtgagggtgcagagctgtacaaagttgagaccaagaatcaggagacactcgac
cgttatggacatggtactcctgatgactggatagagcgcaatgtatataccaaacatagt
gtggctggtattgcgtctatgctgattatcaatgtgattttatttggcccgcttgggttg
acgatctgggctgtgcaaatgatgtggacgccagtgatggctgcgggtgtcataaatggt
atcggacactactggggctatcgcaatttccgctcggaggatgccagtcgtaatatcgtt
ccgtggggaatcctgatcggtggggaagagttgcataacaaccatcatgcctatccgact
tctgccagattatccaacaagtggtatgaattcgatattggctggatgtatatccggata
ctggaaatgatgggactggcacgagtgaagaaaatagctcccaagttgcagttgaataaa
gccaaaaccgaatgtgatctggaaacattacaggcggttatttcccaccggtatgagatt
ctggcgaaatacaccaaatcattgaagatcgcacttaagaatgagctggtgcatttgcag
caggctgcaattgaaaatggtgtggatggtttgactttgagaaactgggtgctggctgac
gccaagaccttgaaagaggaggaacgtactaagctggagacggtattaagccatgctcag
aagctggataagctttatcgcatgagagaagaactgtctttgatatgggaacgttctgca
gcaaccaaggatgagttgcttaagcaactggaggattggtgtcgtcgtgcggaagaaagt
ggtattgaattactggagaaattctcccgcagattacgatgctatgccatggcctag

DBGET integrated database retrieval system