KEGG   Nitrosomonas europaea: NE1467Help
Entry
NE1467            CDS       T00130                                 

Definition
Fatty acid desaturase, type 2:Fatty acid desaturase, type 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
neu  Nitrosomonas europaea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NE1467
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NE1467
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NE1467
Lipid biosynthesis proteins [BR:neu01004]
 Desaturase
  First
   NE1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1600138..1601334)
Genome map
AA seq 398 aa AA seqDB search
MDDIASILMNGLIDLPWWGYIVVALVFTHITIASITIFLHRYQAHRSLELHPIPSHFFRF
WLWLTTGMVTKEWAAVHRKHHAKCETVDDPHSPQVFGIKKVLGEGAELYKVETKNQETLD
RYGHGTPDDWIERNVYTKHSVAGIASMLIINVILFGPLGLTIWAVQMMWTPVMAAGVING
IGHYWGYRNFRSEDASRNIVPWGILIGGEELHNNHHAYPTSARLSNKWYEFDIGWMYIRI
LEMMGLARVKKIAPKLQLNKAKTECDLETLQAVISHRYEILAKYTKSLKIALKNELVHLQ
QAAIENGVDGLTLRNWVLADAKTLKEEERTKLETVLSHAQKLDKLYRMREELSLIWERSA
ATKDELLKQLEDWCRRAEESGIELLEKFSRRLRCYAMA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgcatcaatattgatgaatggactcattgatctgccctggtggggctat
attgttgtggcgctggtatttacccacataacgattgccagtatcaccatttttctgcat
cgttatcaggcacatcggtcacttgagttacaccctatacccagtcatttctttcgtttc
tggctgtggctgacaaccggcatggtaaccaaggaatgggcagcagttcaccggaaacat
catgcaaaatgtgaaaccgtggatgatcctcacagcccacaggtctttggtataaaaaag
gtattgggtgagggtgcagagctgtacaaagttgagaccaagaatcaggagacactcgac
cgttatggacatggtactcctgatgactggatagagcgcaatgtatataccaaacatagt
gtggctggtattgcgtctatgctgattatcaatgtgattttatttggcccgcttgggttg
acgatctgggctgtgcaaatgatgtggacgccagtgatggctgcgggtgtcataaatggt
atcggacactactggggctatcgcaatttccgctcggaggatgccagtcgtaatatcgtt
ccgtggggaatcctgatcggtggggaagagttgcataacaaccatcatgcctatccgact
tctgccagattatccaacaagtggtatgaattcgatattggctggatgtatatccggata
ctggaaatgatgggactggcacgagtgaagaaaatagctcccaagttgcagttgaataaa
gccaaaaccgaatgtgatctggaaacattacaggcggttatttcccaccggtatgagatt
ctggcgaaatacaccaaatcattgaagatcgcacttaagaatgagctggtgcatttgcag
caggctgcaattgaaaatggtgtggatggtttgactttgagaaactgggtgctggctgac
gccaagaccttgaaagaggaggaacgtactaagctggagacggtattaagccatgctcag
aagctggataagctttatcgcatgagagaagaactgtctttgatatgggaacgttctgca
gcaaccaaggatgagttgcttaagcaactggaggattggtgtcgtcgtgcggaagaaagt
ggtattgaattactggagaaattctcccgcagattacgatgctatgccatggcctag

DBGET integrated database retrieval system