KEGG   Nitrosomonas europaea: NE1511Help
Entry
NE1511            CDS       T00130                                 

Gene name
dsbC
Definition
hypothetical protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
neu  Nitrosomonas europaea
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1645372..1646085)
Genome map
AA seq 237 aa AA seqDB search
MHLFLRSLILPGLFFAGIVLADSADLKETIQAHFPESKIESVTQTPYLGLYEVVIDGEVF
YTDKKADYFFMGHVVDAKRRVSLTSERMQQIRDARRIAIDTLPLEHAMKTVKGNGKRMLI
VYSDPNCPYCKRLEKELVNVTDVTIHTLLYPILNGSMTTAEAIWCSEDRVKAWDDFMLRS
VAPAGKDCQTPLQKLLESGRENRVTGTPTLIFADGSVVPGFIPQQEIEKRLDQAASK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgtttttacgttcattgattctgccgggcctgttttttgccggaatcgtcctg
gcagatagtgctgatctgaaagagaccattcaggcccattttccggaaagcaaaattgag
agtgtgacccagaccccttatctggggttatatgaggtcgtgatcgacggagaagtgttt
tatacagataagaaggcagattatttctttatggggcatgtggtcgatgccaaacgacgg
gttagtctgaccagcgagcgtatgcagcagatccgcgatgcgcggcggatcgcaatcgat
accctgccgctggagcatgcgatgaaaacagtcaagggaaacgggaaacgcatgctgatc
gtatattccgatccgaactgcccttactgtaaaaggctggaaaaagagctggtcaatgtg
acggatgtcaccatccataccctgctttatcccattctcaacggctccatgacaacggct
gaagcaatctggtgttctgaagatcgggtcaaggcgtgggatgatttcatgctgcgatca
gttgctccagccggcaaggactgtcaaacacctctgcaaaaattgctggaatcaggccgg
gaaaacagggttacaggaacacctaccctaatttttgctgatggttcggtggtacccggg
tttattccgcagcaggaaatcgaaaaacggctggatcaggcggcaagtaaataa

DBGET integrated database retrieval system