KEGG   Nitrosomonas europaea: NE1694Help
Entry
NE1694            CDS       T00130                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
neu  Nitrosomonas europaea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE1694
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1694
   00052 Galactose metabolism
    NE1694
   00500 Starch and sucrose metabolism
    NE1694
   00520 Amino sugar and nucleotide sugar metabolism
    NE1694
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NE1694
   00524 Butirosin and neomycin biosynthesis
    NE1694
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NE1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1823456..1824463)
Genome map
AA seq 335 aa AA seqDB search
MDQYLLSGDIGGTKTLLRSAVVRGEEVEFHHEHLYDSHQYDDFDAILADFLERSGCQPVA
ACLAVAGPIVEQQVHLTNLPWMISAAGIAEKFSIPAVKIINDFEGTAASIEILPQDDLIT
LQAGKPSSSAMRVVLGAGTGMGVAWLAWRGQYYEPLATEAGHIDFAPTSAIQIELLRYLM
VRYHRVSIERLLSGQGLTHIFNFLQTRATEGTHLKSIELNVDDGATVTRLAFEHHYPIAL
QALDLFVEIYGTYAGNLALAGLCRGGVYIAGGIAPRIIRILQQSGFIEAFCNKGRYSALV
RDIPVYVVMNPKAGLLGAGLLAQRMLQHQTVSSRQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtacctgttgtctggcgacatcggtggaaccaagactctgttacgttctgcc
gtggtaagaggtgaagaggttgaattccatcatgagcatctctatgacagtcaccagtac
gatgattttgacgccattctggcagattttctggagcgatccggctgccagccggttgct
gcttgcctggcagtagccgggccgatcgttgaacaacaggttcatctgaccaatctgccc
tggatgatcagtgcagccggcattgcagaaaaattttcgattcccgccgtgaaaattatc
aatgatttcgagggaacagcagcttccatagaaatattgccgcaggatgatctgattaca
ttgcaggccggtaaaccttcttcttcggcaatgcgtgtcgtgctgggagcagggaccggt
atgggcgttgcctggctggcctggcgcggccagtactatgagccccttgcgactgaggcg
ggacatatcgattttgcaccgaccagtgccattcagatcgaactgctccggtatctgatg
gtcaggtatcaccgtgtttcgatcgagcggctgctttccggccaggggttgacccacatt
ttcaattttctgcaaacccgcgccactgaagggactcatctcaaaagtatcgaactgaac
gtcgacgatggagccaccgtgactcgtctggcattcgaacatcactacccgattgccttg
caggcgctggatctgttcgtggaaatttacggtacttatgcgggcaacctggcgctggcg
gggttgtgccgcggtggtgtctatattgcgggagggatcgcaccacgtatcatccggatt
ttgcagcaatccggtttcatcgaggcgttttgcaacaagggacgatacagtgcgctggtg
cgtgatattcctgtgtatgtggtaatgaatccgaaggccggtctgctgggtgccggactg
cttgcgcagcgcatgctgcagcatcagactgtatcatcccggcagtaa

DBGET integrated database retrieval system