KEGG   Nitrosomonas europaea: NE1779Help
Entry
NE1779            CDS       T00130                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
neu  Nitrosomonas europaea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE1779 (tpiA)
   01230 Biosynthesis of amino acids
    NE1779 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1779 (tpiA)
   00051 Fructose and mannose metabolism
    NE1779 (tpiA)
   00562 Inositol phosphate metabolism
    NE1779 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NE1779 (tpiA)
Enzymes [BR:neu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NE1779 (tpiA)
Exosome [BR:neu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NE1779 (tpiA)
  Exosomal proteins of bladder cancer cells
   NE1779 (tpiA)
  Exosomal proteins of melanoma cells
   NE1779 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1922996..1923754)
Genome map
AA seq 252 aa AA seqDB search
MGRAGFVAGNWKMHGSLVRNQELLDAVVSGTRSLQNVSCVVCVPYPYIAQTQSVLEGSHV
LWGGQNVSQYHHGAYTGEVSADMLADLGCRYVIVGHSERRTLFGEGNQVVAEKFRAAQER
SITPILCVGETLAQRESDETEQVIAMQLDAVIDLAGIEALGQSVIAYEPVWAIGTGKTAT
PQQAQDVHKFIRSRIAVHSGGIAENIQILYGGSVKADNARELFTMPDIDGGLIGGASLVA
AEFISICLAAQN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtgcagggtttgtggccgggaactggaaaatgcatggcagcctggttcggaat
caggagttgcttgatgcggttgtttcaggtactcgctcgttgcagaatgtatcctgtgtg
gtgtgtgtgccttacccctatatagcacagacacagtcagtgcttgagggctctcatgtg
ctatggggggggcagaatgtcagtcagtaccaccacggagcttataccggggaagtatcg
gcagatatgctggccgatttagggtgtcggtacgtgattgtgggtcattcagaacgacga
acactgttcggcgaagggaatcaggtcgtcgctgaaaaatttcgtgctgcacaagagcgt
tcgataacaccaatactttgtgtaggtgagaccctggctcagcgtgaatcggatgagact
gaacaggtaatcgctatgcaactcgatgccgtgattgatctggcgggtatcgaagcgctc
ggacaatcagtcatagcttatgagccggtgtgggcaatcggtactggcaaaactgctact
ccccaacaggcgcaggatgtccataaatttataagaagtcggatagctgttcatagtggc
gggattgctgagaatatccagatactttatggtggaagtgtaaaagcagataatgcacgt
gaattgttcacaatgcctgatatagatggtgggctgatcggaggggcttcgctggttgct
gcggagtttatttcgatttgtctggcagcacagaattaa

DBGET integrated database retrieval system