KEGG   Nitrosomonas europaea: NE1780Help
Entry
NE1780            CDS       T00130                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
neu  Nitrosomonas europaea
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE1780 (gpmA)
   01230 Biosynthesis of amino acids
    NE1780 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1780 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NE1780 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE1780 (gpmA)
Enzymes [BR:neu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NE1780 (gpmA)
Exosome [BR:neu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NE1780 (gpmA)
  Exosomal proteins of melanoma cells
   NE1780 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1923957..1924706
Genome map
AA seq 249 aa AA seqDB search
MKKLVLLRHGESIWNQENRFTGWTDVDLTPKGLKEAEEAGRLLRENGFSFDIAYTSLLKR
AIRTLWIALDEMDQMWTPIELNWRLNERHYGALQGLNKAETAKQYGDEQVLVWRRSYDIR
PPSITINDERYPGFDLRYRNMSSGDIPLAESLKDTVARFLPYWNQSIAPQIKAEKKVIIA
AHGNSLRALIKHLDNISDQDILNCNIPTGIPLVYELDDDLKPLNSYYLGDAGQIGEAISA
VANQGKSGA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgttctcctgcgacacggagaaagtatctggaatcaggaaaatcgcttt
accggctggactgacgtcgatttaacgcccaagggactaaaagaagccgaagaggcaggc
agattgcttcgcgaaaacggtttctccttcgacattgcttatacatctctactcaaacgg
gcaattcgtacactctggatcgcactggacgaaatggatcagatgtggaccccgatcgag
ctcaactggcgactcaatgaacggcattacggggcacttcagggtttgaacaaagcagaa
accgccaaacaatatggcgatgaacaagtactcgtctggagacgcagttacgatatccgc
ccaccttccatcacaatcaacgacgaacgctatcccggctttgatcttcgctacagaaac
atgtcatccggcgatattccgcttgctgaaagtctcaaggatacggttgcaagatttctg
ccctactggaatcagtcaatcgctccacaaatcaaggcagaaaaaaaggtaatcattgct
gcacatggaaattcgctgcgcgctctgatcaaacacctcgataatatctcggaccaggat
atcctgaattgcaatatacccacagggattccgctagtttatgaactggatgacgacttg
aaaccactcaacagttactatctgggagatgctggccaaattggggaagccatttcggcg
gtcgccaatcagggtaaatccggagcttga

DBGET integrated database retrieval system