KEGG   Nitrosomonas europaea: NE1780Help
Entry
NE1780            CDS       T00130                                 

Definition
(GenBank) Phosphoglycerate mutase family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
neu  Nitrosomonas europaea
Pathway
neu00010  Glycolysis / Gluconeogenesis
neu00260  Glycine, serine and threonine metabolism
neu00680  Methane metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
neu01230  Biosynthesis of amino acids
Module
neu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1780
  Energy metabolism
   00680 Methane metabolism
    NE1780
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE1780
Enzymes [BR:neu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NE1780
Membrane trafficking [BR:neu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NE1780
Exosome [BR:neu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NE1780
  Exosomal proteins of melanoma cells
   NE1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: CAD85691
JGI: NE1780
UniProt: Q82TU0
Position
1923957..1924706
Genome map
AA seq 249 aa AA seqDB search
MKKLVLLRHGESIWNQENRFTGWTDVDLTPKGLKEAEEAGRLLRENGFSFDIAYTSLLKR
AIRTLWIALDEMDQMWTPIELNWRLNERHYGALQGLNKAETAKQYGDEQVLVWRRSYDIR
PPSITINDERYPGFDLRYRNMSSGDIPLAESLKDTVARFLPYWNQSIAPQIKAEKKVIIA
AHGNSLRALIKHLDNISDQDILNCNIPTGIPLVYELDDDLKPLNSYYLGDAGQIGEAISA
VANQGKSGA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgttctcctgcgacacggagaaagtatctggaatcaggaaaatcgcttt
accggctggactgacgtcgatttaacgcccaagggactaaaagaagccgaagaggcaggc
agattgcttcgcgaaaacggtttctccttcgacattgcttatacatctctactcaaacgg
gcaattcgtacactctggatcgcactggacgaaatggatcagatgtggaccccgatcgag
ctcaactggcgactcaatgaacggcattacggggcacttcagggtttgaacaaagcagaa
accgccaaacaatatggcgatgaacaagtactcgtctggagacgcagttacgatatccgc
ccaccttccatcacaatcaacgacgaacgctatcccggctttgatcttcgctacagaaac
atgtcatccggcgatattccgcttgctgaaagtctcaaggatacggttgcaagatttctg
ccctactggaatcagtcaatcgctccacaaatcaaggcagaaaaaaaggtaatcattgct
gcacatggaaattcgctgcgcgctctgatcaaacacctcgataatatctcggaccaggat
atcctgaattgcaatatacccacagggattccgctagtttatgaactggatgacgacttg
aaaccactcaacagttactatctgggagatgctggccaaattggggaagccatttcggcg
gtcgccaatcagggtaaatccggagcttga

DBGET integrated database retrieval system