KEGG   Nitrosomonas europaea: NE1934Help
Entry
NE1934            CDS       T00130                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
neu  Nitrosomonas europaea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE1934
   01230 Biosynthesis of amino acids
    NE1934
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1934
   00030 Pentose phosphate pathway
    NE1934
   00051 Fructose and mannose metabolism
    NE1934
   00052 Galactose metabolism
    NE1934
  Energy metabolism
   00680 Methane metabolism
    NE1934
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NE1934
Protein phosphatases and associated proteins [BR:neu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NE1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2089391..2090650
Genome map
AA seq 419 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASAAGLLETARAHSDKIGKVYAGRNGIIGALTEDLIDTSAE
STEAIRALRHTPSGAFGSCRYKLKSLEDNRREYERLIEVFKAHDIGYFFYNGGGDSADTC
LKVSQLAGTLGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSMLEASFDVASMAKT
STKVFILEVMGRHAGWIAAAGGLASNEDHEVPIIILFPEVTFDQEKFLAKTDHYVKEYGY
CTVVVSEGVKGTDGKFLSDQGLRDAFGHAQLGGVAPVIANIVKNGLGLKYHWGVADYLQR
AARHIASGTDVEQAYAMGKAAVEYAIAGHNSVMPTIERISSSPYAWKTGMVELSKVANVE
KMMPADFISEDGFGITGKCREYLSPLIEGEDYPPYKNGLPDYVRLKNVAVTKKLAEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctataaaaaatgcgttctatgctcaatctggcggtgtaactgctgtaatcaatgct
tcagcagcaggtttactggaaacggcacgagcacattccgacaaaatcgggaaagtttac
gccgggcgtaacggcatcatcggagcactgaccgaagatctgatcgataccagtgcagaa
tccactgaagcaatccgggcactgcgccatacgccctccggtgcttttggctcctgtcgc
tacaaactgaaaagcctggaagacaaccggcgcgaatacgagcgtctgatcgaagtattc
aaggcccatgacatcggttatttcttctataacggcggtggtgattcggccgatacctgc
ctgaaagtctcacagcttgccggcacactcggttatccgattcaggcaattcatgtaccc
aagacggttgacaacgatctgcccatcactgattgttgcccgggattcggctcagttgca
aaatatattgccgtttccatgctggaagcaagtttcgatgtggccagcatggccaaaact
tcaaccaaagtattcattctggaagtaatgggccgccatgcgggatggattgcagctgca
ggcgggctggcttccaatgaagatcacgaggttccgatcattatcctgttcccggaagtt
acttttgatcaggaaaagtttctggccaaaacggatcattacgtcaaagaatacggctat
tgtacggttgtagtatcagagggcgtaaaaggtaccgatggcaaatttctgtccgatcag
ggattgcgcgatgccttcgggcacgctcagttaggcggagtagcgccggtaattgcgaat
atcgtcaaaaatggtttggggctgaaatatcactggggtgtcgctgattatctgcagcgt
gctgcgcggcatattgcttccggcacagacgtggagcaagcctatgccatgggtaaagca
gcagtagaatacgcgattgccggacataattccgtcatgccgaccatcgaacgtatctcc
agttcgccctacgcctggaaaaccggtatggtcgagctttccaaagtggcaaatgtggaa
aagatgatgcccgcagatttcatcagtgaagatggtttcggcattaccggcaaatgtcgt
gaatacctcagcccactgatcgaaggagaagattacccgccgtataaaaacggactacct
gattatgtcaggctgaaaaatgttgcagtaactaaaaagctggctgagttcaaaatttaa

DBGET integrated database retrieval system