KEGG   Nitrosomonas europaea: NE1934Help
Entry
NE1934            CDS       T00130                                 

Definition
(GenBank) Phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
neu  Nitrosomonas europaea
Pathway
neu00010  Glycolysis / Gluconeogenesis
neu00030  Pentose phosphate pathway
neu00051  Fructose and mannose metabolism
neu00052  Galactose metabolism
neu00680  Methane metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE1934
   00030 Pentose phosphate pathway
    NE1934
   00051 Fructose and mannose metabolism
    NE1934
   00052 Galactose metabolism
    NE1934
  Energy metabolism
   00680 Methane metabolism
    NE1934
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NE1934
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NE1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAD85845
JGI: NE1934
UniProt: Q82TF4
Position
2089391..2090650
Genome map
AA seq 419 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASAAGLLETARAHSDKIGKVYAGRNGIIGALTEDLIDTSAE
STEAIRALRHTPSGAFGSCRYKLKSLEDNRREYERLIEVFKAHDIGYFFYNGGGDSADTC
LKVSQLAGTLGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSMLEASFDVASMAKT
STKVFILEVMGRHAGWIAAAGGLASNEDHEVPIIILFPEVTFDQEKFLAKTDHYVKEYGY
CTVVVSEGVKGTDGKFLSDQGLRDAFGHAQLGGVAPVIANIVKNGLGLKYHWGVADYLQR
AARHIASGTDVEQAYAMGKAAVEYAIAGHNSVMPTIERISSSPYAWKTGMVELSKVANVE
KMMPADFISEDGFGITGKCREYLSPLIEGEDYPPYKNGLPDYVRLKNVAVTKKLAEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctataaaaaatgcgttctatgctcaatctggcggtgtaactgctgtaatcaatgct
tcagcagcaggtttactggaaacggcacgagcacattccgacaaaatcgggaaagtttac
gccgggcgtaacggcatcatcggagcactgaccgaagatctgatcgataccagtgcagaa
tccactgaagcaatccgggcactgcgccatacgccctccggtgcttttggctcctgtcgc
tacaaactgaaaagcctggaagacaaccggcgcgaatacgagcgtctgatcgaagtattc
aaggcccatgacatcggttatttcttctataacggcggtggtgattcggccgatacctgc
ctgaaagtctcacagcttgccggcacactcggttatccgattcaggcaattcatgtaccc
aagacggttgacaacgatctgcccatcactgattgttgcccgggattcggctcagttgca
aaatatattgccgtttccatgctggaagcaagtttcgatgtggccagcatggccaaaact
tcaaccaaagtattcattctggaagtaatgggccgccatgcgggatggattgcagctgca
ggcgggctggcttccaatgaagatcacgaggttccgatcattatcctgttcccggaagtt
acttttgatcaggaaaagtttctggccaaaacggatcattacgtcaaagaatacggctat
tgtacggttgtagtatcagagggcgtaaaaggtaccgatggcaaatttctgtccgatcag
ggattgcgcgatgccttcgggcacgctcagttaggcggagtagcgccggtaattgcgaat
atcgtcaaaaatggtttggggctgaaatatcactggggtgtcgctgattatctgcagcgt
gctgcgcggcatattgcttccggcacagacgtggagcaagcctatgccatgggtaaagca
gcagtagaatacgcgattgccggacataattccgtcatgccgaccatcgaacgtatctcc
agttcgccctacgcctggaaaaccggtatggtcgagctttccaaagtggcaaatgtggaa
aagatgatgcccgcagatttcatcagtgaagatggtttcggcattaccggcaaatgtcgt
gaatacctcagcccactgatcgaaggagaagattacccgccgtataaaaacggactacct
gattatgtcaggctgaaaaatgttgcagtaactaaaaagctggctgagttcaaaatttaa

DBGET integrated database retrieval system