KEGG   Nitrosomonas europaea: NE2029Help
Entry
NE2029            CDS       T00130                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
neu  Nitrosomonas europaea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:neu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2190147..2192351)
Genome map
AA seq 734 aa AA seqDB search
MKSLSSSSPGSSEDSAQSLLLTARLYDPCSFLGMHAAPNGRLIRVFQPYMSRVWLHTLSG
YQPMRSVHQDGIFEWEGEGVMHPYLLRMENTATGVIEERHDPYAFPMQISGHDLYLFNEG
RLLQAYHMLGAHRVRNHGVTGTRFAVWAPNAERVSVVGDFNRWDGRVYPMMVHGHSGVWE
LFIPDLPEGAIYKYEIRNRISGEILLKTDPYATTYELRPNNAALTPIEQKYDWKDDDWIA
RRKGWDWLHAPLNIYELHVGSWKRHPDGRFYSYHELADHLIPYLQDMGYSHVELLPISEH
PLDESWGYQATGYFAVTSRYGSPEAFMSFVDRCHQAGIGVILDWVPAHFPQDSFSLARFD
GTALYEHEDPRLGYHHDWGTYIFNYGRNEVKSFLLSSAHYWLSAFHIDGLRVDAVASMLY
LNYSRKEGEWLPNRYGGHENLEAIEFLRALNTMVHGEFPGALTFAEESTSWPAVSRPAYL
GGLGFSMKWNMGWMNDTLSYMQHDPVHRRYHHNELTFNQLYAYTENFVLPLSHDEVVHGK
KSMLDKMPGDGWQKFANLRLLFTYQMTCPGKKINFMGNELGQGHEWRVGHELDWYLLERD
PHRGIQALTRDLNHLYLNTPALHELDFFAEGFSWIDCHDVEQSVISYQRHARDGSFVLVV
LNFTPILRTGYRVGIPGSSAYQEVFNSDSIYYDGSNAGNAGKISPTGQPWSGQPDSIIIT
LPPLAGVILKAADG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccttatcttcttcatccccgggttcgtcggaggattctgcacaatcattactg
ctgaccgccaggctgtacgatccctgttctttcctgggaatgcacgctgctccaaatggc
aggctgatcagggtgtttcagccttatatgtcacgtgtgtggctgcataccctgtcgggc
tatcagccaatgcgaagcgtacatcaggacgggatcttcgaatgggagggggaaggggtc
atgcacccctatctgctgcgtatggaaaatacggcaaccggggtgatcgaagaacggcat
gatccctatgccttccccatgcagatttcaggccacgacttgtatctgttcaatgaaggg
cgcctgcttcaggcttatcatatgctgggtgctcaccgggtcaggaatcatggtgtcacc
ggcacacgttttgccgtatgggcaccgaatgccgaacgggtcagcgtcgttggagatttc
aatcgctgggatggcagggtatatcccatgatggtgcatggccacagcggggtatgggag
ctgttcattccggatttacccgagggagcgatatataaatatgaaatccgcaatcggatc
agcggtgagatcctgctcaagaccgacccttatgcaacgacatatgaactgcgccccaat
aatgccgcactgactccgatcgagcagaaatacgactggaaggatgacgattggatagcc
cggcgcaaaggctgggactggctgcatgcccctctcaacatctatgaactgcatgtcggt
tcgtggaagcgccatccggatggcagattctattcctatcatgaacttgccgatcatctg
attccttatctgcaggatatggggtattcccatgtcgaattgctgccgatatcggaacat
ccgctggatgaatcatgggggtatcaggccaccggctattttgcggtgacgagccgctat
ggcagtccggaagcattcatgagcttcgtggacagatgtcatcaggccgggattggcgtg
attctcgactgggttcccgcacattttccgcaggacagtttttcactggcgcggtttgac
ggcactgccctgtatgagcatgaagatccgcggctgggctaccaccacgactggggaaca
tatatcttcaattatggccgcaacgaggtgaaatcctttctgctctccagcgcccattac
tggctgtctgcttttcatatcgatggtttacgtgtggatgccgtggcttccatgctttac
ctgaattactcacgcaaggaaggagaatggctgccaaaccgctatggcggacatgaaaat
ctggaagcgatcgagtttctgcgggcactgaataccatggtgcacggggaatttccgggt
gcgctgacattcgccgaggaatccacttcctggccggcggtatcccgcccggcctacctt
ggcggattgggcttctccatgaaatggaacatgggctggatgaatgatacgctgagttat
atgcagcatgacccggtgcatcggcgctatcaccacaacgagctgacgttcaaccagctc
tatgcctacaccgaaaatttcgtgctgccgctttcgcatgatgaagtggtgcatggcaag
aagtccatgctggacaagatgccgggcgatggctggcagaaatttgccaatctgcgcctg
ctgtttacctatcagatgacctgcccgggcaagaaaatcaacttcatgggaaatgaactc
ggccaggggcatgaatggcgcgtgggtcatgaactcgactggtacctgctggaacgtgat
ccgcatcgcggtatacaggcgctgacgcgcgatctgaaccacctttacctgaatacaccg
gcgctgcatgaactggatttctttgccgaaggtttttcctggatcgattgccatgacgtg
gagcaatcggtcatcagctaccagcgccacgccagagatggatcatttgtgctggtagtg
ctcaactttaccccgatactgcgtaccggttaccgtgtcggcatcccgggatcgagtgct
taccaggaagtgttcaacagtgattcaatttattacgacggcagtaatgccggaaatgcc
ggaaaaatcagcccgaccgggcaaccctggtccggccagcctgattccatcatcattaca
ctgcctcctttggcaggtgtcattctgaaagcggcagatggttga

DBGET integrated database retrieval system