KEGG   Nitrosomonas europaea: NE2262Help
Entry
NE2262            CDS       T00130                                 

Gene name
bktB
Definition
(GenBank) Thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
neu  Nitrosomonas europaea
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NE2262 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    NE2262 (bktB)
   00640 Propanoate metabolism
    NE2262 (bktB)
   00650 Butanoate metabolism
    NE2262 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    NE2262 (bktB)
   00072 Synthesis and degradation of ketone bodies
    NE2262 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NE2262 (bktB)
   00310 Lysine degradation
    NE2262 (bktB)
   00380 Tryptophan metabolism
    NE2262 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NE2262 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NE2262 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NE2262 (bktB)
Enzymes [BR:neu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NE2262 (bktB)
Exosome [BR:neu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NE2262 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2450711..2451889
Genome map
AA seq 392 aa AA seqDB search
MRNVVVLSGARTAIGDYGGALKDLAPATLAAITVREAITRASVDSDKIGHLVAGHVIPTE
AQDMYLARVAALEAGLPQSVAALTLNRVCGSGLQAIISAAQAVMLGDTEVAIAAGAESMS
RGGYLLPALRWGQRMQDSTAVDMMVGALTDPFDRVHMGITAENIAERWSITREQQDRFAL
ESHRRAIHAVHNGYFREQIVPVEVSTREGVAMFDTDQHPRDNISMETLGKLRPVFREDGT
VTAGNASGINDGAAALVLMEERAAERNHHQPMARLVAYGHAGVNPRYMGIGPVPAVKQAL
NRAGLDLAEMDVIESNEAFAVQACAVARELNFDPDKVNPNGGAVALGHPIGASGCILAIK
AIYELQRINGRYALVTLCIGGGQGIAAIFEKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgtcgtcgttctcagtggcgcaagaaccgcgatcggtgattacggtggcgcg
ctgaaggatctggcgcctgccacgctggcagccataacggtcagggaagcaatcactcgc
gccagcgtcgattctgacaagattgggcacctcgtcgccgggcacgttatccccactgaa
gcgcaggatatgtatctggcgcgcgtggcggcgctggaagccggcctgccgcagagtgta
gcggcgcttaccctgaatcgtgtttgcggcagtggattgcaggccatcatttcagctgcg
caggccgtgatgctgggagatacggaagtggctatcgctgctggagccgagtcgatgagt
cgaggaggatatcttcttcccgcactgcgctggggacaacgtatgcaagacagtaccgca
gtcgatatgatggtgggcgcactgaccgatccgtttgaccgggtacacatgggaatcact
gcagaaaacattgctgaaagatggagcattacccgcgagcagcaggatcgattcgcactg
gaaagtcatcggcgcgccattcacgctgttcacaacggctatttccgcgagcagatcgta
ccggttgaagtttccacccgcgaaggtgtagcgatgttcgatacagaccagcacccgcgc
gacaacatcagtatggaaacgctgggtaaactgcgccctgttttccgggaagacggcaca
gtcacggccggtaacgcatccggcatcaatgatggtgctgccgcactggtgctgatggag
gaacgcgcagccgaacggaatcatcatcaaccgatggcacgtctggtcgcttatggccac
gccggagtcaatccgcgctacatgggaatcggccccgtgcccgcagtcaaacaggcactg
aaccgggccgggctcgatctggctgagatggatgtcatcgaatccaatgaggcgtttgct
gtccaggcgtgcgcagtcgcccgggaactgaatttcgacccggacaaagtcaatccaaac
gggggcgccgtggcactggggcatcccattggtgcatccggttgtatactggcaatcaaa
gccatttacgagctgcagcgtataaacggccgctatgcactggtcactttgtgcatcggt
ggcggacagggaatcgccgcaatttttgaaaaactctga

DBGET integrated database retrieval system