KEGG   Nitrosomonas europaea: NE2368Help
Entry
NE2368            CDS       T00130                                 

Definition
(GenBank) Aspartate aminotransferase (EC:2.6.1.1)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
neu  Nitrosomonas europaea
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NE2368
   01230 Biosynthesis of amino acids
    NE2368
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NE2368
   00290 Valine, leucine and isoleucine biosynthesis
    NE2368
   00220 Arginine biosynthesis
    NE2368
Enzymes [BR:neu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NE2368
    2.6.1.66  valine---pyruvate transaminase
     NE2368
Amino acid related enzymes [BR:neu01007]
 Aminotransferase (transaminase)
  Class I
   NE2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2573829..2575055
Genome map
AA seq 408 aa AA seqDB search
MQPIKKSSKLDNVCYDIRGPVLDRARQMEDEGQRVIKLNIGNPASFGFEAPDEILQDVIR
NLSAASGYCDSKGLFAARKAIMHYTQEKNIANVQMDDIYIGNGVSELIMLATQALLENGD
EILVPSPDYPLWTAAISLAGGVARHYTCDEQSSWLPDPENIKAQVSSRTRAIVIINPNNP
TGALYPDDLLREIIEIARRNNLIIFADEIYDKILYDSASHTSVASLADDVLFVTFNGLSK
NYRAAGFRSGWVVVSGNKTHARDYITGLNMLASMRLCANVPAQFGIQTALGGYQSIHDLT
MPTGRLKRQRDLAWKLLTDIPGVTCFKPQSALYLFPRLDPDYYPVKDDEQFALDLLLEEK
VLVVQGTGFNWSQPDHFRIVFLPNSDDLTEAIGRIAKFLDRYRTRHGS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccatcaagaaatccagcaaactcgataatgtctgctacgacatacgcggcccg
gttctcgatcgcgccagacaaatggaggatgaaggccagcgtgttatcaagctcaacatc
ggcaatcctgcttccttcgggttcgaggcgccggacgagattctgcaggatgtcatccgc
aatctttctgctgcatccggttattgcgattccaaagggttgtttgctgcccgcaaagcc
atcatgcactacacgcaggaaaaaaatatcgccaacgtgcagatggatgacatttatatc
gggaatggcgtatcggaactgatcatgctggccacgcaggcgctgctggaaaatggtgat
gaaatactggttccctcgccggattacccgctgtggacggcagccatctcgcttgccggc
ggggttgcacgtcattacacctgtgacgaacaatccagctggctgcccgatccggaaaac
ataaaagcccaggtcagcagcagaacccgggccatcgtaatcatcaaccccaacaacccg
accggtgcgctgtatccggatgatctgttgcgcgaaatcattgaaattgcccggcgtaac
aatctgatcatttttgcggatgaaatctacgacaaaattctttacgactctgccagccac
acttcggttgcctcgctggctgatgatgttttattcgttacattcaacggtttatccaaa
aactaccgtgcagccggctttcgctccggctgggtcgtcgtttccggtaacaagactcat
gcacgggattacattaccgggctcaacatgctggcatcgatgcgcctgtgcgccaatgtt
ccggcacaattcggcatccagactgcattaggcggttatcagagcatacatgatctcacc
atgcctaccggccggctgaaacggcagcgtgatctggcctggaaactgctgaccgacatc
ccgggcgtgacctgcttcaaaccgcagagtgcactgtacctgttcccacgactcgatccc
gactactatccagttaaagatgatgaacagtttgcactggatctgctgctggaagagaag
gtgctggtggtacagggaaccgggttcaactggtcgcaacccgatcatttccggatcgtg
tttctacccaacagtgatgatttgacagaagcaatcggccggatcgcgaagtttctcgac
cgttatcgcacccgccacggcagttga

DBGET integrated database retrieval system