KEGG   Nitrosomonas europaea: NE2370Help
Entry
NE2370            CDS       T00130                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
neu  Nitrosomonas europaea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NE2370 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE2370 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NE2370 (thrC)
Enzymes [BR:neu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NE2370 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576601..2578034
Genome map
AA seq 477 aa AA seqDB search
MRYLSTRGGMSPRTFTEILLTGLAPDGGLAMPEAYPEISSATLESWRPLDYPSLAFEILS
RFMDDIPADDLRTLIARTYTPEIFGSKDITPVQTLEPDLHLLHLSNGPTLAFKDIAMQFM
GNLFEYVLAKNNDELNILGATSGDTGSSAEYAMRGKQGIHVFMLSPYGKMSAFQTAQMFS
LQDENIFNIAIEGVFDDCQDIVKTVSNDQAFKQQYRIGAVNSINWARIAAQVVYYFKAYF
AVTRSSDEVVSFSVPSGNFGNIFAGHVARMMGLPIRKLILATNENDVLDEFFRTGLYRPR
STAETRQTSSPSMDISKASNFERFIFDLTGRDAERVKELWKSVDQGGSFDLSGTDLWAKI
RDFGITSGTSCHAERINTIREIYRKFNVLIDTHTADGLKTGMALREPGIPLICLETALPV
KFADSIREAVGFELEQPAGYDNLESLPQRFERMAADAEQVKQFMASRIDSSDKINKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctttcgactcgcggcggcatgtcgcccagaacatttactgaaatactgctg
accggcctggcacccgatggcgggctggccatgccggaagcctatccggaaatcagctcg
gcaacgcttgaatcctggcgaccactcgactacccgtcacttgcgttcgaaattctgtcg
cgtttcatggatgacatccctgccgacgatttgcgcacactgatcgcacgcacttatacc
cctgagatatttggcagtaaagacattacacccgtccagacgctcgaacccgatctgcat
ctgctacacctgtccaatggacccacgctggcattcaaggatattgccatgcagttcatg
ggtaacctgttcgaatacgttctggcaaaaaataacgatgaactgaatattctgggtgca
acgtccggcgataccggctccagtgcggaatatgccatgcgcgggaaacaggggatccac
gtattcatgctgtcaccctacggcaaaatgagtgcttttcagacagcacagatgttttca
ctccaggatgaaaacatcttcaacatcgcgatcgaaggggtattcgacgactgccaggat
atcgtcaaaacagtcagtaatgatcaggcattcaaacagcaatatcggatcggcgccgtc
aattcaatcaactgggctcgcatcgccgcacaggtggtttactacttcaaggcctatttc
gcagtcacccgttccagcgacgaagtggtctcgttttccgtcccttccggcaacttcggc
aacatttttgccggccatgtcgctcgtatgatgggtctgccaattcggaaactgattctg
gcaaccaatgaaaacgatgtactggatgaatttttccgcaccggtttgtaccggccacgc
tcaacggctgaaaccaggcaaaccagcagcccctcgatggatatttccaaggcatcgaat
ttcgagcgattcatcttcgatctgaccggccgggatgctgaacgagtcaaagaactctgg
aaatcggtcgatcagggaggatcattcgatctctccggtaccgatttatgggcaaaaatc
agagattttggcattacatcagggaccagctgccacgctgaacgcatcaataccattcgc
gagatataccgcaaattcaacgtcctgatcgacacacacactgcagatgggctgaaaaca
gggatggcattgcgcgaacctggcattccactgatctgcctggaaacggcactacccgtc
aaatttgcggacagcatccgggaagcggtcggatttgaactggaacagccggccgggtac
gataatctggaaagtctgccccaacgttttgaacgcatggcggcagatgccgaacaggtc
aaacagttcatggccagccggatcgattcatcagacaaaataaacaagtcataa

DBGET integrated database retrieval system