KEGG   Nitrosomonas europaea: NE2375Help
Entry
NE2375            CDS       T00130                                 

Gene name
sucB
Definition
sucB; dihydrolipoamide succinyltransferase (component of 2-oxoglutarate dehydrogenase complex) protein (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
neu  Nitrosomonas europaea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:neu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:neu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:neu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2583467..2584744
Genome map
AA seq 425 aa AA seqDB search
MLIEVKVPALSESVAEATLINWHKQPGEYVERGENLIDIETDKVVLELPAPQSGILAEII
RNDGATVTSGEIIARIDTAAKETKTAAQQPAPIDSGHLEITESTVASMHPAQPLMPSAKK
AAEENGLTMEEIAAIHGTGRGGRITRQDVLAHVRNKNSAVTDQQSDSRTDQSAAGIPQAD
TSPIPVDQTEKPDRLEKRVPMTRLRMRIAERLVQSQSTAAILTTFNEVNMQAIMDLRARY
KDSFEKEHGIKLGFTSFFVKAVVAALKKFPIINASVDGNDIIYHDYYDIGIAVASPRGLV
VPIIRDADKLTFAGIEKQIADLARRAQEGKLTLEELTGGTFSITNGGVFGSMLSTPIINP
PQSAILGIHATKQRPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAIKEALEYPVS
PLFEG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgaagtcaaagtccccgcattatcagaatcggtagcggaagccacattgatc
aactggcataaacagccaggcgagtatgttgaacggggtgagaacctgatcgacatcgaa
actgataaggtcgtactggaactccctgctccgcagtccggaatcctggctgaaattatc
cggaacgatggcgctaccgtcaccagtggagaaatcattgcccgtatcgataccgctgcc
aaagagacaaaaactgctgcacagcagcctgctccgattgattccggacacctggaaatc
acagaatctacggtagcatccatgcatccggctcagccgctcatgccgtcagccaaaaaa
gctgccgaggaaaatggtcttaccatggaagaaattgcagccattcacggtacaggccgt
ggcggacgcatcacccggcaggatgtgctggcccatgtcagaaacaaaaacagtgccgtt
accgatcagcagtctgattcccgcaccgatcaatctgctgctggtataccccaggcagac
acttccccgataccagtcgatcagacagaaaaaccagatcggctggaaaaacgcgtaccc
atgacgcgtttacgcatgcgcattgctgaacggctggtacagtcccaatctacagcagcc
attctgactacgttcaacgaagtcaacatgcaggcaatcatggatttgcgcgcccgttac
aaggacagctttgagaaagaacatggtatcaaactcggctttacttcattttttgtcaaa
gctgtggttgccgccctcaagaaatttcctatcatcaacgcatcggtagatggaaatgac
atcatctatcacgactattacgatatcggcatagcagtggccagtccacgtggtctggtc
gtgccgatcatccgtgatgccgataagctcaccttcgccgggatcgaaaaacagattgct
gatctggccagacgggcacaggaggggaaactcacactggaagaactgacaggaggtacg
ttctccattaccaatggaggcgtatttggctcgatgctctcgacaccgatcatcaacccg
ccccaaagcgcaattcttggcattcatgccaccaagcaacgcccggtcgtcgagaatggg
cagattgtaatccggccgatcaactatctggcactttcctatgatcaccgcatcatcgac
gggcgcgaagctgtcctgtcgctggtcgcgatcaaggaagcactggaatatccggtcagc
ccgttattcgagggttga

DBGET integrated database retrieval system