KEGG   Nitrosomonas europaea: NE2534Help
Entry
NE2534            CDS       T00130                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
neu  Nitrosomonas europaea
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2774013..2774477)
Genome map
AA seq 154 aa AA seqDB search
MSQIPQAAIALAKRFEGFHKVPKSDPLRRARPYICLAGYWTIGYGRLCKPDHPPIDEEEG
EAYLYQDLRKALAATLRYCPVLATEPESRLAAIVDFTFNLGAGRLQTSTMRRRINQRDWL
SAGQELRRWVHGGGKVLPGLVARREAEVLLLVPG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagccagattccccaagccgctatcgccctggcgaaacgatttgagggtttccacaag
gttcccaaatcagatccactgcgccgcgcccgtccctacatttgtctggccggctactgg
acgatcggctacgggcgtttgtgcaagccggaccatccaccgatcgacgaggaagagggc
gaggcctacttgtatcaggatctgcgcaaagccctcgccgccacgctgcgctactgcccg
gtgctggccaccgagcccgagagccggctcgcggccattgtcgacttcaccttcaacctt
ggtgccggtcgactgcagacatctacgatgcgtcggcgaatcaaccagcgagactggctt
tctgcgggccaagagttgcggcgctgggtgcacggtggcggcaaggtactgccggggctg
gtagctcgccgcgaagccgaagtccttttgttggtgcccggctaa

DBGET integrated database retrieval system