KEGG   Nocardia farcinica IFM 10152: NFA_31850Help
Entry
NFA_31850         CDS       T00207                                 

Gene name
hisG
Definition
(GenBank) putative ATP phosphoribosyltransferase
  KO
K00765  
ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NFA_31850 (hisG)
Enzymes [BR:nfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     NFA_31850 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
Position
complement(3379422..3380273)
Genome map
AA seq 283 aa AA seqDB search
MLRVAVPNKGALSESATSILSEAGYRKRTDSRDLSVLDPENQVEFYFLRPKDIAVYVGSG
ELDLGITGRDLALDSGAPVQERLALGFGRSTFRYAAPAGREWKVEDLYDKRIATSYPNLV
LSDLRRRGIEAEVIRLDGAVEISIQLGVADAIADVVGSGRTLRQHNLVAFGETLCDSEGV
LVERVGADRDDRARNQLVARIQGVVFAQQYLMLDYDCPKELLDQAVQITPGLESPTVSPL
ADEGWVAVRALVPRGKGNSVMDRLADLGAKAILATDIRSCRAF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgtcgcagtccccaacaaaggcgcactgtccgaatccgcgacctcgatcctg
agcgaggccgggtaccgcaagcgcaccgactcccgcgacctgagcgtgctcgacccggag
aaccaggtcgagttctacttcctgcgtccgaaggacatcgccgtctacgtcggctccggc
gagctcgacctcggtatcaccggccgtgacctggcgctggattccggcgcaccggtgcag
gagcggctcgcgctcggcttcggccgctccaccttccgctacgccgcgccggccggccgg
gagtggaaggtcgaggacctctacgacaagcggatcgccacctcctatccgaacctggtg
ctgagcgacctgcgccgccgcggcatcgaggccgaggtcatccggctcgacggcgcggtg
gagatctccatccagctcggcgtcgccgacgccatcgccgacgtggtgggttcgggccgc
acgctgcgccagcacaacctggtcgccttcggcgagacgctgtgcgactcggagggggtg
ctcgtcgagcgggtcggagccgaccgcgacgaccgcgcccgcaaccagctcgtcgcccgt
atccagggtgtcgtgttcgcccagcagtacctgatgctggactacgactgccccaaggaa
ctgctcgaccaggcggtgcagatcacccccggcctggagtcgccgacggtctctccgctg
gccgacgagggctgggtcgcggtgcgcgcgctggtaccgcgcggcaagggcaattcggtg
atggatcggctggccgacctcggcgccaaggcgatcctggccaccgacatccggtcctgc
cgcgcgttctga

DBGET integrated database retrieval system