KEGG   Nocardia farcinica IFM 10152: NFA_48350Help
Entry
NFA_48350         CDS       T00207                                 

Gene name
fadA10
Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00071  Fatty acid degradation
nfa00072  Synthesis and degradation of ketone bodies
nfa00280  Valine, leucine and isoleucine degradation
nfa00310  Lysine degradation
nfa00362  Benzoate degradation
nfa00380  Tryptophan metabolism
nfa00620  Pyruvate metabolism
nfa00630  Glyoxylate and dicarboxylate metabolism
nfa00640  Propanoate metabolism
nfa00650  Butanoate metabolism
nfa00900  Terpenoid backbone biosynthesis
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa01130  Biosynthesis of antibiotics
nfa01200  Carbon metabolism
nfa01212  Fatty acid metabolism
nfa02020  Two-component system
Module
nfa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NFA_48350 (fadA10)
   00630 Glyoxylate and dicarboxylate metabolism
    NFA_48350 (fadA10)
   00640 Propanoate metabolism
    NFA_48350 (fadA10)
   00650 Butanoate metabolism
    NFA_48350 (fadA10)
  Lipid metabolism
   00071 Fatty acid degradation
    NFA_48350 (fadA10)
   00072 Synthesis and degradation of ketone bodies
    NFA_48350 (fadA10)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NFA_48350 (fadA10)
   00310 Lysine degradation
    NFA_48350 (fadA10)
   00380 Tryptophan metabolism
    NFA_48350 (fadA10)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NFA_48350 (fadA10)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NFA_48350 (fadA10)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NFA_48350 (fadA10)
Enzymes [BR:nfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NFA_48350 (fadA10)
Exosome [BR:nfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFA_48350 (fadA10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAD59687
NIH_Japan: nfa48350
UniProt: Q5YQ54
Position
5049248..5050468
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSTARSPIGRARKGSLVDMRPDDLASQIVRAALDKVPALDPTQIDDLILGCGSP
AGEQGFNIARNVAVMLGYDTLPGTTVHRYCASSLQSTRMAFHAIKAGEGHAFISAGVETV
SRYVHGSADSWPNTQNPIFADAQARTAKAAEGGAGIWHDPREDGLLPDVYIAMGQTAENV
ASFTGITREDQDRWGVRSQNRAEEAINNGFFEREITPVTLPDGTVVSKDDGPRAGVTYEA
VSQLKPVFRPDGTVTAGNCCPLNDGAAALVIMSDVRAKELGLTPLARIVSTGVSGLSPEI
MGLGPIESVKNALALANMSVDDIDLFEINEAFAVQVLGSARELKIDEDKLNVSGGAIALG
HPFGMTGARITATLINNLQTYDKQFGVETMCVGGGQGMAMVLERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggcagttatcgtttcgaccgcacgctctcccatcggtcgtgcccgcaagggc
tcgctggtcgacatgcgtcccgacgatctggcctcccagatcgtgcgcgccgcactggac
aaggttcccgcgctcgaccccacccagatcgacgacctgatcctcggctgcggctcgccc
gcgggtgagcagggcttcaacatcgcccgcaacgtcgcggtcatgctcggctacgacacc
ctgcccggcaccaccgtgcaccgctactgtgcctcgtcgctgcagtcgacccggatggcc
ttccacgccatcaaggcgggcgagggccacgccttcatctccgcgggcgtggagacggtg
tcgcgctacgtgcacggctcggccgacagctggccgaacacccagaacccgatcttcgcc
gacgcgcaggcgcgcacggcgaaggccgccgagggcggcgcgggcatctggcacgacccg
cgcgaggacggcctgctgcccgacgtctacatcgcgatgggccagaccgccgagaacgtc
gccagcttcaccggcatcacccgcgaggaccaggaccgctggggcgtgcgttcgcagaac
cgcgcggaggaggccatcaacaacggcttcttcgagcgcgagatcaccccggtcacgctg
cccgacggcacggtcgtcagcaaggacgacgggccgcgcgccggcgtcacctacgaggcc
gtctcccagctcaagccggtcttccggccggacggcaccgtcaccgcgggcaactgctgc
ccgctcaacgacggtgcggccgcgctggtgatcatgagcgacgtgcgcgccaaggagctg
ggcctgaccccgctggcccgcatcgtgtccaccggcgtgtccggcctgtcgccggagatc
atgggcctcggcccgatcgagtcggtcaagaacgcgctggcgctggcgaacatgagcgtc
gacgacatcgacctgttcgagatcaacgaggccttcgcggtgcaggtgctcggctcggcc
cgcgagctgaagatcgacgaggacaagctcaacgtctccggcggcgcgatcgcgctcggc
cacccgttcggcatgaccggcgcccgcatcaccgcgacgctgatcaacaacctgcagacc
tacgacaagcagttcggcgtcgagacgatgtgcgtcggcggcggccagggcatggcgatg
gtgctcgagcgcctgagctga

DBGET integrated database retrieval system