KEGG   Nocardia farcinica IFM 10152: NFA_5170Help
Entry
NFA_5170          CDS       T00207                                 

Gene name
fadA3
Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NFA_5170 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    NFA_5170 (fadA3)
   00640 Propanoate metabolism
    NFA_5170 (fadA3)
   00650 Butanoate metabolism
    NFA_5170 (fadA3)
  Lipid metabolism
   00071 Fatty acid degradation
    NFA_5170 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    NFA_5170 (fadA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NFA_5170 (fadA3)
   00310 Lysine degradation
    NFA_5170 (fadA3)
   00380 Tryptophan metabolism
    NFA_5170 (fadA3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NFA_5170 (fadA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NFA_5170 (fadA3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NFA_5170 (fadA3)
Enzymes [BR:nfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NFA_5170 (fadA3)
Exosome [BR:nfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFA_5170 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
Position
complement(532009..533172)
Genome map
AA seq 387 aa AA seqDB search
MGTPVIVEAARTPIGKRGGWLAGLHAAELLGLAQRGLLERAHLDPALVEQVVGGCVTQAG
EQSNNITRVAWLHAGLPWQVGATTIDAQCGSAQQANHLIAGLIAADAIDIGMACGVEAMS
RVPLGANVGENAGPRRPASWSIDLPNQFEAAERIAKRRGITRDDVDEFGLRSQRLAAQAW
AEGRFEREIIPVTAPAVDKEGTLTGEKLDVTRDQGLRETTKEGLAKLKPVLEGGVHTAGS
SSQISDGAAAVLLMDEKAAERTGLRPRARIRTQVLVGGEPEFHLDGPVQACSRLLERSGM
SIGDIDLFEINEAFASVALSWASVHKPDMDRVNVNGGAIALGHPVGSTGSRLITTALHEL
ERTGGATAMILMCAGGAMATGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcacacccgtcatcgtcgaggccgctcgcaccccgatcggcaagcgcggcggctgg
ctcgccggcctgcacgccgccgaactgctcggcctcgctcaacgcggactgctcgaacgc
gcccacctggatccggccctggtcgagcaggtcgtcggcggctgcgtcacccaggcaggc
gagcagtccaacaacatcaccagggtcgcgtggctgcacgcgggcctgccctggcaggtc
ggcgccaccaccatcgacgcccagtgcggctcggcccagcaggccaaccacctgatcgcc
ggcctgatcgccgccgacgccatcgacatcggcatggcgtgcggcgtcgaggcgatgagc
cgggttccgctgggcgccaacgtcggcgagaacgccggcccgcgccgcccggcgtcgtgg
agcatcgatctgccgaatcagttcgaggccgccgagcggatcgccaagcggcgcggcatc
acccgcgacgacgtcgacgagttcggcctgcgctcccagcgcctggccgcccaggcctgg
gcggagggtcgtttcgagcgcgagatcatccccgtcaccgcccccgccgtcgacaaggag
ggcaccctcaccggcgagaagctcgacgtcacgcgcgaccaggggctgcgcgagaccacc
aaggagggcctggccaagctgaagccggtgctggagggcggcgtgcacaccgcggggagc
tcctcgcagatctccgacggcgcggccgcggtactgctgatggacgagaaggccgccgag
cgaacgggtttgcggccgcgggcgcgtatccgcacccaggtgctggtcggcggcgagccg
gagttccacctggacggacccgtgcaggcctgctcgcgcctgctggagcgctcgggtatg
agcatcggcgacatcgacctgttcgagatcaacgaggccttcgcctcggtggcgctgtcg
tgggcgtcggtgcacaagccggacatggatcgggtcaacgtcaacggtggcgcgatcgcc
ctcggccaccccgtcggctccaccggatcgcgcctcatcacaaccgctttgcacgagctg
gagcggaccggcggcgccacggcgatgatcctgatgtgcgccggtggagccatggccacc
ggtaccatcatcgaacggatctag

DBGET integrated database retrieval system