KEGG   Nocardia farcinica: nfa10230Help
Entry
nfa10230          CDS       T00207                                 

Definition
branched-chain alpha-keto acid dehydrogenase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nfa  Nocardia farcinica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa10230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    nfa10230
   00020 Citrate cycle (TCA cycle)
    nfa10230
   00620 Pyruvate metabolism
    nfa10230
Enzymes [BR:nfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     nfa10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1124734..1126266
Genome map
AA seq 510 aa AA seqDB search
MHDDGNVLEFRLPDLGEGLTDAELVSWSVAVGDHVDLNQTIAEVETAKAVVALPCPYAGT
VAALLADPGETVPVGAPLIRVRADGAGSAVGSGGDAARGAENGSGAGSGGGAPGGGGAAT
ADGADIGNGGGSTVPAENAGAGGGAGADASASASFDAGADADADAGGGGGGGAGAGAGAD
SDAGAASGNGRRSVLVGYGPEAEQQTRRRRTTAPVPVARPAAVAARPAATPAARKLAREL
GVDLWQVDGSGPNGAVTVDDVRAAATPTGAAVAEPGPAREERTPVTGVRKRTAAAMVTSA
TTIPQASTFVTVDCTATMELIDHLRTTPAFAGLSLTPLVVVAKAVLAALAEFPGVNAQWD
EERQQIVTKRYVHLGIAAATDRGLLVPSVKEAHRLSLRELCAEIGRTIEAARAGTATPAD
LTGGTFTITNVGVFGVDSGVPLVNPGEAAILCLGAIGRRPWVVADELAVRWVTTLGLSFD
HRLIDGELAARFLATVAGLLTDPLTLLSRL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgacgacggcaacgtcctggagttccggctgccggatctgggggagggactcacc
gatgccgaactggtgtcctggtcggtcgccgtcggcgaccacgtggacctgaaccagacc
atcgccgaagtggagaccgcgaaggccgtggtcgccctgccctgcccgtacgcggggacg
gtggcggcactgctggccgacccgggggagacggtgccggtgggggcgccgctgatccgg
gtccgggcggatggcgcggggtcggcggtggggagcggtggtgacgcggcgcgcggtgcc
gagaacggttccggcgccgggagtggaggcggcgccccgggcggtggcggagccgccacc
gcggacggtgccgatatcgggaacggcggcgggtcgacggtccccgccgaaaacgccggt
gcgggtggcggtgcgggcgccgatgccagtgccagtgccagtttcgatgccggtgccgat
gccgatgccgatgccggtggcggtggcggcggtggtgctggtgctggtgctggtgccgac
tccgacgccggtgcggcgagcgggaacggcaggcgctcggtgctcgtcggctacgggccc
gaagccgagcaacagacccggcgccggcggacgaccgccccggtgccggtcgcccgtccg
gccgcggtcgccgcgcgcccggccgccacccccgcggcccggaagctggcccgcgagttg
ggggtggatctctggcaggtcgacggctcgggtccgaacggggcggtgaccgtcgacgac
gtgcgcgcggccgcgacaccgaccggtgccgccgtggccgagcccggcccggcgcgcgag
gaacgcaccccggtcaccggggtgcgcaaacgcaccgcggccgccatggtcacgagcgcg
acgacgatcccgcaggccagtaccttcgtcaccgtcgactgcaccgcgacgatggagctg
atcgaccatctgcgcaccaccccggcgttcgccgggctcagcctgaccccgctggtcgtg
gtggccaaggcggtgctggcggcgctggcggagttccccggagtgaacgcgcagtgggac
gaggagcggcagcagatcgtcaccaagcgctacgtccacctcggcatcgccgccgccacc
gaccgcggcctgctcgtgccgtcggtcaaggaggcgcaccggctgagcctgcgcgagttg
tgtgccgagatcggccggacgatcgaggccgcccgggcgggcaccgccaccccggccgac
ctcaccggtggcaccttcacgatcaccaacgtcggcgttttcggcgtggattccggtgtg
ccgctggtcaatccgggggaggcggcgatcctgtgcctgggcgcgatcggcaggcggccg
tgggtggtggccgacgagctggcggtccgctgggtcaccacgctcgggctgagcttcgac
caccggctcatcgacggcgaactcgcggcccgtttcctcgccacggtcgcgggtctgctg
accgatccgctcacgctgctgagccggttgtag

DBGET integrated database retrieval system