KEGG   Nocardia farcinica: nfa10500Help
Entry
nfa10500          CDS       T00207                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nfa  Nocardia farcinica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    nfa10500 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    nfa10500 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    nfa10500 (thrC)
Enzymes [BR:nfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     nfa10500 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1159201..1160295
Genome map
AA seq 364 aa AA seqDB search
MSTAGVAPQAGVHSRWPGLIAAYRDRLAGAADWEPVTLFEGGTPLVPAPYLSELTGCEVY
LKVEGANPTGSFKDRGMTMAMTDAKYRGQQAVLCASTGNTSASAAAYATRAGMTCAVLIP
QGKIAMGKLAQAVMLGAQIIQVEGNFDDCLELARKVTAEFPAVGLVNSVNPARIEGQKTA
SFEICDVLGKAPDVHALPVGNAGNITAYWRGYREYYADGITGSLPRMLGVQAAGAAPLVH
GAPVKEPETIATAIRIGAPASWNGAVAAKEESGGAFRAATDEEILAAYRLVAAKEGVFVE
PASAASVAGVLAARADGWLEPGLTVVCTVTGNGLKDPDTALLGMPQVEAIKVDPVAVATR
LELA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcaggagtcgccccccaggccggcgtgcattcccgctggccgggtctgatc
gcggcctaccgtgatcggctcgcgggcgcggccgactgggagccggtcacgctgttcgag
ggcggcaccccgctggtgcccgctccgtacctgtcggagctgaccggctgcgaggtgtac
ctgaaggtcgagggcgccaacccgacggggtcgttcaaggaccgcgggatgacgatggcg
atgaccgacgccaagtaccgcggccagcaggcggtgctgtgcgcgtccaccggcaacacc
tcggcgtcggccgcggcctacgccacccgggcgggcatgacctgcgcggtgctgatcccg
cagggcaagatcgcgatgggcaagctggcccaggcggtcatgctgggcgcgcagatcatc
caggtcgagggcaacttcgacgactgtctcgagctggcccgcaaggtcaccgccgagttc
ccggccgtcggcctggtcaactcggtcaacccggcccgcatcgagggccagaagaccgcc
tcgttcgagatctgcgacgtgctcggcaaggcgccggacgtgcacgcgctaccggtgggc
aacgcgggcaacatcaccgcctactggcgcggataccgcgagtactacgccgacggcatc
accggctcgctgccgcgcatgctcggcgtgcaggccgcgggcgcggcgccgctggtgcac
ggcgcgccggtcaaggagcccgagaccatcgcgaccgccatccgcatcggcgcccccgcc
tcgtggaacggcgcggtcgcggccaaggaggagtccggcggtgcgttccgcgcggccacc
gacgaggagatcctcgccgcgtaccgcctggtggccgccaaggaaggcgtgttcgtcgaa
cccgcctcggcagccagtgtcgccggtgtgctcgccgcgcgtgcggacggctggctggag
cccgggctcaccgtggtgtgcacggtgaccggcaacggcctcaaggaccccgacaccgcg
ctgctcggcatgccgcaggtggaggcgatcaaggtcgaccccgtggccgtggccacccga
ctcgagctggcctga

DBGET integrated database retrieval system