KEGG   Nocardia farcinica: nfa10500Help
Entry
nfa10500          CDS       T00207                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nfa  Nocardia farcinica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nfa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nfa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nfa00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1159201..1160295
Genome map
AA seq 364 aa AA seqDB search
MSTAGVAPQAGVHSRWPGLIAAYRDRLAGAADWEPVTLFEGGTPLVPAPYLSELTGCEVY
LKVEGANPTGSFKDRGMTMAMTDAKYRGQQAVLCASTGNTSASAAAYATRAGMTCAVLIP
QGKIAMGKLAQAVMLGAQIIQVEGNFDDCLELARKVTAEFPAVGLVNSVNPARIEGQKTA
SFEICDVLGKAPDVHALPVGNAGNITAYWRGYREYYADGITGSLPRMLGVQAAGAAPLVH
GAPVKEPETIATAIRIGAPASWNGAVAAKEESGGAFRAATDEEILAAYRLVAAKEGVFVE
PASAASVAGVLAARADGWLEPGLTVVCTVTGNGLKDPDTALLGMPQVEAIKVDPVAVATR
LELA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcaggagtcgccccccaggccggcgtgcattcccgctggccgggtctgatc
gcggcctaccgtgatcggctcgcgggcgcggccgactgggagccggtcacgctgttcgag
ggcggcaccccgctggtgcccgctccgtacctgtcggagctgaccggctgcgaggtgtac
ctgaaggtcgagggcgccaacccgacggggtcgttcaaggaccgcgggatgacgatggcg
atgaccgacgccaagtaccgcggccagcaggcggtgctgtgcgcgtccaccggcaacacc
tcggcgtcggccgcggcctacgccacccgggcgggcatgacctgcgcggtgctgatcccg
cagggcaagatcgcgatgggcaagctggcccaggcggtcatgctgggcgcgcagatcatc
caggtcgagggcaacttcgacgactgtctcgagctggcccgcaaggtcaccgccgagttc
ccggccgtcggcctggtcaactcggtcaacccggcccgcatcgagggccagaagaccgcc
tcgttcgagatctgcgacgtgctcggcaaggcgccggacgtgcacgcgctaccggtgggc
aacgcgggcaacatcaccgcctactggcgcggataccgcgagtactacgccgacggcatc
accggctcgctgccgcgcatgctcggcgtgcaggccgcgggcgcggcgccgctggtgcac
ggcgcgccggtcaaggagcccgagaccatcgcgaccgccatccgcatcggcgcccccgcc
tcgtggaacggcgcggtcgcggccaaggaggagtccggcggtgcgttccgcgcggccacc
gacgaggagatcctcgccgcgtaccgcctggtggccgccaaggaaggcgtgttcgtcgaa
cccgcctcggcagccagtgtcgccggtgtgctcgccgcgcgtgcggacggctggctggag
cccgggctcaccgtggtgtgcacggtgaccggcaacggcctcaaggaccccgacaccgcg
ctgctcggcatgccgcaggtggaggcgatcaaggtcgaccccgtggccgtggccacccga
ctcgagctggcctga

DBGET integrated database retrieval system