KEGG   Nocardia farcinica: nfa10690Help
Entry
nfa10690          CDS       T00207                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nfa  Nocardia farcinica
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nfa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nfa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1177754..1179034
Genome map
AA seq 426 aa AA seqDB search
MSERFLVTGGNRLVGEVAVGGAKNSVLKLMAAALLAEGTTTITNCPDILDVPLMAEVLRG
LGCEVTITDDAPGDRSVVTITTPAEPKYHADFPAVTQFRASVCVLGPLMARCKRAVVALP
GGDAIGSRPLDMHQAGLRLLGATSEIEHGCVVARAEELRGARIRLDFPSVGATENILMAA
VLAEGETVIDNAAREPDIVDLCNMLVQMGARISGAGTSVLTIQGVERLHPTEHRVIGDRI
VAATWGIAAAMTMGDVRVTGVNPKHLALVLDKLRSAGARISFDVDGFRVVQPDRPRAVNF
STLPFPGFPTDLQPMAIGLAAIADGTSMITENIFEARFRFVEEMIRLGADARTDGHHAVV
RGIPRLSSAPVWSSDIRAGAGLVLAGLVADGTTEVHDVFHIDRGYPNFVEQLQSLGGLVE
RVGGAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacggtttctggtcaccgggggcaatcggctcgtcggcgaggtcgcagtggga
ggcgcgaagaacagcgtcctcaagctgatggcggccgcgctgctggccgagggcacgacg
acgatcacgaactgcccggacatcctcgacgttccgctgatggcggaggtgctgcgcggc
ctcggttgcgaggtgaccatcaccgacgacgcgccgggggaccggtcggtggtcaccatc
accaccccggccgaaccgaagtaccacgccgacttcccggccgtcacccagttccgcgcc
tcggtgtgcgtgctcgggccgctgatggcccggtgcaagcgcgcggtcgtggcactgccc
ggcggtgacgccatcggttcccgtccgctcgacatgcaccaggctggtctgcggctgctc
ggtgcgaccagcgagatcgagcacggctgcgtcgtcgcccgcgccgaggaactgcgcggc
gcccggatccgcctcgacttcccctcggtgggcgccaccgagaacatcctcatggcggcg
gtgctcgccgagggcgagaccgtcatcgacaacgccgcccgcgagcccgacatcgtcgac
ctgtgcaacatgctcgtgcagatgggcgcccggatcagcggggcgggcacctcggtgctc
accatccagggcgtcgagcgcctccatcccaccgagcaccgcgtgatcggcgaccgcatc
gtcgccgccacctggggcatcgcggccgccatgacgatgggcgacgtgcgggtgaccggc
gtgaaccccaagcacctggccctggtgctggacaagctgcgctcggcgggtgcgcgaatc
tccttcgatgtggacggcttccgggtggtgcaacccgatcgcccgcgcgcggtgaacttc
tcgacgctgccgttccccggcttcccgaccgacctgcagccgatggccatcggcctggcc
gcgatcgccgacggcacctcgatgatcaccgagaacatcttcgaggcgcggttccggttc
gtggaggagatgatccggctgggcgccgacgcgcgcaccgacggtcaccacgccgtggtg
cgcggaatcccgcggctgtcgagcgcgccggtgtggtcctccgacatccgggcgggcgcc
ggcttggtgctcgccggcctggtggccgacggcaccaccgaggtgcacgacgtcttccac
atcgaccgcgggtacccgaacttcgtcgagcagctgcagtcgctcggcgggctcgtcgag
cgggtgggcggcgcggagtag

DBGET integrated database retrieval system