KEGG   Nocardia farcinica: nfa13700Help
Entry
nfa13700          CDS       T00207                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nfa  Nocardia farcinica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    nfa13700
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     nfa13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1535800..1536663)
Genome map
AA seq 287 aa AA seqDB search
MTTPVIAVLGSINMDLVTTTARRPAPGETVLGSGFDTVPGGKGANQAVAARRSGGRVEFL
GAVGTDVFAPQLRGALESVGVGTAGLRTVPGPSGVASIVVDESGENSIIVVGGANAAMTA
LRETDRAMIAAADVLVCQLEIPVPTVAAGLRHARANGTTVLLNPSPAQDLPPQLWADVDV
AVVNRGEERQLGAVLDRVPHVVVTLGGAGARYRGPDGAELAVPGVPVEVVDTTGAGDAFT
GALAVTWRHGPAAALRWACAAGALATTRLGASASIPERAAIEDLLAR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgcccgtgatcgccgtgctcggcagcatcaacatggatctggtgaccaccacc
gcccgcaggcctgcgccgggggaaaccgtgctgggcagcgggttcgacaccgtcccgggc
gggaagggggcgaaccaggccgtcgcggcgcgccggtccggcggccgggtggagttcctg
ggcgcggtgggcaccgacgtgttcgccccgcagttgcgcggcgcgctcgagtcggtcggc
gtcggcaccgcgggcctgcgcacggtgcccgggcccagcggggtggcgtcgatcgtcgtg
gacgagtccggggagaacagcatcatcgtcgtgggcggcgccaatgccgcgatgacggcg
ttgcgcgagaccgaccgggcgatgatcgcggcggcggacgtgctggtgtgccaactggag
atcccggtgccgacggtggccgccgggctgcggcacgcgcgggcgaacgggaccaccgtc
ctgctgaatccgtcacccgcacaggatcttccgccacagctgtgggcggacgtcgatgtc
gcggtggtcaaccggggtgaggagcggcagctcggcgcggtactggatcgggtgccgcac
gtggtggtcaccctcggcggtgcgggcgcccggtatcgcggcccggacggggcggaactg
gccgtgcccggcgtgcccgtcgaggtcgtcgacaccaccggcgccggtgacgcgttcacc
ggcgcgctggcggtgacctggcggcacgggcccgccgcggcgctgcgctgggcgtgtgcg
gccggggcgctggcgaccacgcgcctcggcgcgagcgcgtcgatccccgagcgggccgcg
atcgaggacctgctggcccgctga

DBGET integrated database retrieval system