KEGG   Nocardia farcinica: nfa14460Help
Entry
nfa14460          CDS       T00207                                 

Definition
oxidoreductase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nfa  Nocardia farcinica
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    nfa14460
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     nfa14460
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     nfa14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1629988..1630557
Genome map
AA seq 189 aa AA seqDB search
MTLVQVMAQDDRDQVVLRTADRTEIADTLRPFGIQLDRWPLRELPADAGQDAVLAAYRAE
VDEVCRAGGYRFVDVVRLVPAPEDPEWPARAAAARGRFLDEHRHTEHEVRFFVEGRGCFY
LHLGDKVYALVCEAGDLVSVPAGTTHWFDMGAQPHFCAIRFFEREDGWIGDFTGSPIAST
MPTLDELVG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtacaggtgatggcgcaggacgaccgcgaccaggtcgtgctgcgcaccgcc
gaccgcaccgagatcgccgacaccctgcggcctttcggtatccagctcgaccggtggccg
ctgcgtgagctgcccgccgacgcgggccaggacgcggtgctcgccgcctaccgcgcggag
gtggacgaggtctgccgcgcgggcgggtaccggttcgtcgacgtcgtgcggctggtgccc
gcccccgaagaccccgagtggcccgcccgggccgccgccgcccgcggccgtttcctcgac
gagcatcgccacaccgagcacgaggtccgcttcttcgtcgagggtcgcggctgcttctac
ctgcatctcggcgacaaggtctacgcactggtctgcgaggcgggggatctggtctcggtg
cccgcgggcaccacgcactggttcgacatgggcgcgcagccgcacttctgcgccatccgc
ttcttcgaacgcgaggacggctggatcggggacttcaccggtagcccgatcgcgtccacc
atgcccaccctcgacgaactcgtcggctga

DBGET integrated database retrieval system