KEGG   Nocardia farcinica: nfa14460Help
Entry
nfa14460          CDS       T00207                                 

Definition
oxidoreductase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nfa  Nocardia farcinica
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:nfa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1629988..1630557
Genome map
AA seq 189 aa AA seqDB search
MTLVQVMAQDDRDQVVLRTADRTEIADTLRPFGIQLDRWPLRELPADAGQDAVLAAYRAE
VDEVCRAGGYRFVDVVRLVPAPEDPEWPARAAAARGRFLDEHRHTEHEVRFFVEGRGCFY
LHLGDKVYALVCEAGDLVSVPAGTTHWFDMGAQPHFCAIRFFEREDGWIGDFTGSPIAST
MPTLDELVG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtacaggtgatggcgcaggacgaccgcgaccaggtcgtgctgcgcaccgcc
gaccgcaccgagatcgccgacaccctgcggcctttcggtatccagctcgaccggtggccg
ctgcgtgagctgcccgccgacgcgggccaggacgcggtgctcgccgcctaccgcgcggag
gtggacgaggtctgccgcgcgggcgggtaccggttcgtcgacgtcgtgcggctggtgccc
gcccccgaagaccccgagtggcccgcccgggccgccgccgcccgcggccgtttcctcgac
gagcatcgccacaccgagcacgaggtccgcttcttcgtcgagggtcgcggctgcttctac
ctgcatctcggcgacaaggtctacgcactggtctgcgaggcgggggatctggtctcggtg
cccgcgggcaccacgcactggttcgacatgggcgcgcagccgcacttctgcgccatccgc
ttcttcgaacgcgaggacggctggatcggggacttcaccggtagcccgatcgcgtccacc
atgcccaccctcgacgaactcgtcggctga

DBGET integrated database retrieval system