KEGG   Nocardia farcinica: nfa15660Help
Entry
nfa15660          CDS       T00207                                 

Gene name
kdpA
Definition
potassium-transporting ATPase subunit A (EC:3.6.3.12)
Orthology
K01546  
K+-transporting ATPase ATPase A chain [EC:3.6.3.12]
Organism
nfa  Nocardia farcinica
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nfa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1715637..1717322
Genome map
AA seq 561 aa AA seqDB search
MSPALAAGLQIASVVAVLALVYVPLGDYMARVYTSSSDLRAESWLYRLARVDPRAEQTWC
GYAGSVLGFSLAGVLVLYVLQRIQGVLPLSHGLAGVSPAVAFNTAVSFVTNTNWQSYVPE
TTMSPLTQSAGLAVQNFVSAAVGMAVAVALIRGLVRVGRGGEVGNFWVDLTRGTLRILLP
LAFVIALILLSQGVIQSYRSGFTGVGLDGRPVTTALAPVASQEAIKELGTNGGGVLAANS
AHPFENPTPLSNVVQILAILLIPVALTRTFGTMIGNRRQGLTVLAVMAGIYAVILGVTTA
AESGARGAAATAAGAMLEGKEVRFGIPGSVLFAVSTTGTSTGAVNSAHDSMSPLGGGAVL
VNMLLGEIAPGGVGSGLYGILVLAVIAVFVGGLLVGRTPEFLGKKLRRREITLAALAVLV
MPALVLIGTAITVVLPETAAALGNSGDPGTPGAVHGFSEVLYAYASASNNNGSAFGGLTV
TSDWFQSSLGLCMLFGRFLPILFVLALAGSLAAQPRTPATAGTLPTAGAGFAGLLTGTVV
LVAALTFFPVLALGPIAEALQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgctctcgccgcgggcctgcagatcgcctccgtggtggcagtgctcgccctc
gtctacgtccccctgggcgactacatggcccgggtgtacacgtcctcgtccgacctgcgg
gccgagtcgtggctgtaccggctggcccgtgtcgacccccgcgccgagcagacctggtgc
ggctacgcgggcagtgtgctcgggttctcgctggccggtgtgctggtgctgtatgtgctg
cagcggatccaaggggtgctgccgctgtcgcacgggctcgccggggtgagccccgcggtg
gccttcaacaccgcggtctccttcgtcaccaacaccaactggcagtcctacgtccccgag
accacgatgagcccgctcacccagtcggccgggctggccgtgcagaacttcgtctcggcg
gcggtcgggatggcggtcgcggtggcgctgatccgtggtctggtgcgcgtcgggcgcggc
ggggaggtcggcaacttctgggtcgacctgacccgtggcacgctgcgcatcctgctgccg
ctggccttcgtgatcgcgctgatcctgttgagccagggcgtgatccagtcctaccgcagc
ggcttcaccggtgtcggtctggacgggcggccggtcaccacggcgctggcgccggtcgcc
tcgcaggaagcgatcaaggaactcggaaccaacggcggcggcgtgctggcggccaactcg
gcgcacccgttcgagaatcccacgccgctgagcaatgtcgtgcagatcctcgcgatcctg
ctcattcccgtcgcgctcacccgcaccttcggcaccatgatcggcaaccgtcgacagggc
ttgacggtgctggcggtgatggccgggatctacgccgtgatcctgggggtgaccaccgcg
gcggaatccggggcgcgcggtgcggcggcgacggccgcgggcgcgatgctcgagggcaag
gaggtccgcttcggcatccccggttcggtgttgttcgccgtgtccaccaccggcaccagc
accggcgcggtgaattccgcgcacgacagcatgtccccgctcggcggcggggccgtgctg
gtgaacatgctgctcggcgagatcgcgccgggcggggtgggcagtgggctctacggcatc
ctcgtgctggcggtgatcgccgtgttcgtcggtggcctgctcgtgggacgcacgccggag
ttcctgggcaagaagctgcgccgtcgcgagatcaccctggccgcgctggcggtgctggtg
atgccggcgttggtactgatcggcacggcgatcacggtggtcctgcccgagaccgccgcc
gcattgggcaattccggcgacccgggcaccccgggcgccgtgcacggattcagcgaggtg
ctctacgcctacgcctcggcgtcgaacaacaacggcagcgcgttcggcgggttgaccgtc
accagcgactggttccagtcctcgctgggactgtgcatgctgttcggccggttcctgccg
atcctgttcgtgctggccttggccggttcgctggccgcccagccgcgcacgcccgcgacc
gcgggcaccctgcccaccgccggtgccggtttcgcggggctgctcaccgggaccgtcgtg
ctcgtcgcggccctgaccttcttcccagtcctggctctgggaccgatcgcggaggcactg
caatga

DBGET integrated database retrieval system