KEGG   Nocardia farcinica: nfa18620Help
Entry
nfa18620          CDS       T00207                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nfa  Nocardia farcinica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nfa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nfa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nfa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
2032897..2033697
Genome map
AA seq 266 aa AA seqDB search
MSQQSRLANTFATARAEHRAALIGYLPAGYPDLAGSIATCRAMVESGCDIVEVGVAYSDP
VMDGPTIQAAAEQALRGGVRVRDVFSVVEAITAAGGQAVVMSYWNPVLRYGVERFARDLA
AAGGAGIITPNLIPEEADDWFIASATHNLDRIFLVAPSSTEERLVKTLEASRGFIYAAST
MGVTGARDAVSSAAPALCARIRAHSDIPIGVGLGVRNGAQAAEIASYADGVIVGSALVSA
AGEGLDAVRALTSELAEGVRSATVAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcagtcccgcctcgccaacaccttcgccaccgcgcgcgccgagcaccgggcc
gcgctgatcggctacctgcccgcgggctaccccgacctggccggctccatcgcgacgtgc
cgggcgatggtcgaatccggttgcgacatcgtggaagtcggcgtcgcctactccgatccg
gtgatggacggcccgaccatccaggccgcggccgagcaggcgctgcgcggcggcgtgcgg
gtgcgcgacgtgttctccgtcgtcgaggcgatcaccgccgcgggcgggcaggccgtggtg
atgagctactggaatccggtgttgcgctacggcgtggagcggttcgcccgcgatctggcc
gcggcgggcggggcgggcatcatcacgcccaacctgatccccgaggaggccgacgactgg
ttcatcgcctcggccacccacaatctcgatcgcatcttcctggtcgcgccgtcgtccacc
gaggaacggctggtcaagactctcgaagccagccgcggcttcatctacgcggcctcgacg
atgggtgtcaccggcgcgcgcgacgcggtctcctcggccgcgcccgcgctgtgcgcgcgc
atccgggcgcattccgacatcccgatcggcgtcggcctcggcgtgcgcaacggtgcgcag
gcagccgagatcgcctcctacgccgacggcgtgatcgtcggttccgcgctggtcagcgcc
gcgggcgagggactggacgcggtgcgcgcgctcacctcggagctcgccgagggcgtgcgt
tcggcgaccgtcgcctcctga

DBGET integrated database retrieval system