KEGG   Nocardia farcinica: nfa25030Help
Entry
nfa25030          CDS       T00207                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nfa  Nocardia farcinica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa25030 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    nfa25030 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    nfa25030 (glcB)
Enzymes [BR:nfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     nfa25030 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
2664979..2667159
Genome map
AA seq 726 aa AA seqDB search
MTERIQVGGLQVAKVLHDFIENEALPGSGVDSAAFWAGAEQVITDLAPRNRALLAERDEI
QGKLDAWHAEHPGANYDKAAYKSFLTEIGYLRPEPADFQITTQNVDSEIAETAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAIPEDNGAEKGTGYNKVRGDKVIEWARNFLDDAV
TLITGSHIGSTSYAIVDGELEVGLEDGTTIGLADASQLVGYQGDPAKPTSILLKHNGLHI
DIQIDPESPIGSTDTAGIKDIVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMQGTL
AEEVSKGGKTFTRTMNPDRVYTALDGSELRLHGRSLLFVRNVGHLMTSDAILDAQGNEVP
EGIMDGLITSLIAKHSLREDVELKNSRTGSVYIVKPKMHGPDEVAFTNELFGRIEDVLGL
ARNTLKVGIMDEERRTTVNLKACIEAAKERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKSQQWIASYEDWNVDTGLATGLPGKAQIGKGMWAMPDLMADMLAQKIGHPKSGANTAWV
PSPTAATLHATHYHLVDVFKRQAEIAKGGRRASVDEILEIPLAANPNWSPEEIRQELDNN
SQSILGYVVRWIDQGVGCSKVPDIKDVALMEDRATLRISSQLMANWLRHGIVTADEVVAS
LERMAPVVDRQNAGDPNYRPMAPDFDGSIAFQAAKELILEGTKQPNGYTEPILHRRRREA
KALSRV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggctccaggtggccaaggttctccacgacttcatc
gagaacgaggcactgcccggctccggcgtagattccgccgcgttctgggcgggtgcggag
caggtgatcaccgatctggctccgcgcaaccgcgccctgctggccgaacgcgacgagatc
cagggcaagctcgacgcctggcacgcggagcacccgggcgcgaactacgacaaggccgcc
tacaagagcttcctcaccgagatcggttacctgcggcccgaacccgccgatttccagatc
accacccagaacgtcgacagcgagatcgccgagaccgcgggcccgcagctggtcgtgccg
gtgatgaacgcgcgcttcgcgatcaacgccgccaacgcgcgctggggctcgctctacgac
gccctctacggcaccgacgccatccccgaggacaacggcgcggagaagggcaccggctac
aacaaggtccgcggcgacaaggtcatcgagtgggcgcgcaacttcctcgacgacgcggtc
accctgatcaccggctcgcacatcggctccacctcgtacgcgatcgtcgacggtgagctc
gaggtcgggctggaggacggcaccaccatcggcctcgccgacgcctcgcaactggtgggc
taccagggcgatccggccaagccgacctcgatcctgttgaagcacaacggcttgcacatc
gacatccagatcgatcccgagtcgccgatcggcagcaccgacaccgcgggcatcaaggac
atcgtgctcgagtccgccgtcaccaccatcatggacttcgaggactcggtcgccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctcggactgatgcagggcacgctg
gccgaagaggtcagcaagggcggcaagaccttcacccgcaccatgaaccccgaccgcgtc
tacaccgcgctcgacgggtccgagctgcgcctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacctgatgacctccgacgccatcctcgacgcgcagggcaacgaggtgccc
gagggcatcatggacggcctgatcacctcgctcatcgccaagcactcgctgcgcgaggac
gtcgagctgaagaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggc
cccgacgaggtggcgttcaccaacgagctgttcggtcgcatcgaggacgtgctcggcctg
gcccgcaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctg
aaggcctgcatcgaggccgccaaggagcgcgtggtcttcatcaacacgggcttcctcgat
cgcaccggcgacgagatccacacctcgatggaggccgggccgatggtccgcaaggccgac
atgaagtcccagcagtggatcgcctcctacgaggactggaacgtcgacaccggcctggcc
accggcctgcccggcaaggcccagatcggcaagggcatgtgggccatgcccgacctgatg
gccgacatgctcgcccagaagatcggccacccgaagtcgggcgccaacaccgcctgggtg
ccctcgccgaccgccgcgaccctgcacgccacccactaccacctggtggacgtgttcaag
cggcaggccgagatcgccaagggcgggcggcgcgcgagcgtcgacgagatcctggagatc
ccgctggcggcgaacccgaactggtcgccggaggagatccgccaggagctggacaacaac
tcccagtccatcctcggctatgtggtgcgctggatcgaccagggcgtcggctgctccaag
gtgcccgacatcaaggacgtcgccctcatggaggaccgcgccaccctgcgcatctccagc
cagctgatggccaactggctgcgccacggcatcgtcaccgccgacgaggtggtggccagc
ctggagcggatggccccggtggtggaccggcagaacgccggcgacccgaactaccgcccg
atggcgccggacttcgacggcagcatcgccttccaggcggccaaggaactgatcctggag
ggcaccaagcagcccaacggctacaccgagccgatcctgcaccgccgccgccgtgaggcc
aaggcgctctcgcgggtgtga

DBGET integrated database retrieval system