KEGG   Nocardia farcinica: nfa25470Help
Entry
nfa25470          CDS       T00207                                 

Gene name
recD
Definition
RecD protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nfa  Nocardia farcinica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    nfa25470 (recD)
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     nfa25470 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
2714218..2716104
Genome map
AA seq 628 aa AA seqDB search
MTSIQLAQRGTGLLRTFNEAGVLSAADVHVAVRLGRLGREESELVLFAAALAVRAVRSGS
VCLELHRMREIGVDADESWDAGTGIDPASLPWPDVEAVIAALRVSPLVCGGPAGPLCPLR
VVPGDDGPLLYLDRYFRQEQTIRRVLTERAASHPRVNAAIVRRELDRLFGADHDGAPDRQ
RLAAALAATHWTTVVAGGPGTGKTHTIARILALLDAHRRADPKAPPLRIALAAPTGKAAA
RLQEAVREQAGELGLPELSAATLHRLLGWQRGRRTRFRHNEFNRLPYDVIVVDETSMVSL
TMMSSLLAALRPDTRLVLVGDPDQLASVDAGAVLADLVAGPVLGTPNPELDRILGGPPPD
LAAHPEGLTALERTRLRSGIVRLTRGRRFGGRIAELAVAVRAGDADRALHLLHTGGDDLS
LCAPDDVATVRADVVRAARTVTAAAQAGDATGALTALESHRLLCAHRQGPFGVERWDRLA
GEWAAAAGAGPDSAQSSWYPGQPLLVTANDHEARIYNGDTGVIVAMPDGSLRAALQRGSE
PYLVHPTQFPAVVTVFAMTIHRSQGSQYDTVSIVLPEPESTLLTRELLYTAITRARGHVR
VIGTEESIRAAVGRRVLRASGLSRPAGG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgatccagctggcgcagcgcggcaccggactgctgcgcaccttcaacgaggcc
ggggtgctctcggccgccgacgtacacgtggcagtgcggctcggcaggctcggccgcgag
gaatccgagctggtgctgttcgccgccgcgctggcggtgcgggcggtgcggtcggggtcg
gtgtgcctggagctgcaccggatgcgcgagatcggggtggacgccgacgagagctgggac
gcgggcaccggcatcgacccggccagcctgccctggccggacgtcgaggccgtgatcgcc
gcgctgcgagtgagcccgctggtgtgcggtggtccggccggcccgctgtgcccgctgcgg
gtcgtacccggcgacgacggcccgctgctgtacctggaccggtacttccggcaggagcag
accatccggcgcgtactcaccgaacgcgccgcgagccacccccgggtgaacgccgcgatc
gtccggcgcgaactcgaccggctgttcggcgccgaccacgacggcgcgcccgatcggcag
cggctggcggccgccctggccgccacgcactggacgacggtggtcgccggcggtccgggc
accggcaagacccacaccatcgcccgcatcctcgcgctgctcgacgcccaccgccgcgcc
gaccccaaggcgccgccgctgcgcatcgccctggccgcccccaccggcaaggccgccgcc
cggctgcaggaggcggtgcgcgaacaggcaggcgagctcggcctgcccgagctgtcggcc
gccaccctgcaccggttgctcggctggcaacgcggccgtcgaacccgcttccgccacaac
gaattcaaccgcctgccctacgacgtgatcgtggtcgacgagacctcgatggtgtcgctg
accatgatgagcagcctgctcgccgcgctacggccggacacccgactggtactcgtcggc
gacccggaccagctggcgtcggtcgacgcgggcgcggtgctcgccgacctcgtcgccggg
ccggtgctcggcacccccaacccggagctggaccgcatcctcggcggccccccacccgac
ctcgccgcgcatccggagggcctgaccgcgttggagcgcacgcggctgcgcagcggcatc
gtccggctcacccgcgggcgccgattcggtggccgcatcgccgaactcgccgtggcggtg
cgcgccggcgacgccgaccgcgcactccacctgctgcacaccggcggcgacgacctgtcg
ctgtgcgcgcccgacgacgtcgccaccgtccgcgccgacgtggtgcgcgccgcccggacc
gtcaccgccgccgcgcaggccggtgacgcgaccggcgcgctgaccgccttggaatcgcat
cggctgttgtgcgcgcaccggcagggcccgttcggtgtggaacgctgggaccggctcgcg
ggggagtgggccgccgcggcgggcgcgggcccggactccgcgcagtcgtcctggtatccg
ggccagccgttgctcgtcaccgccaacgaccacgaggcccgcatctacaacggcgacacc
ggggtgatcgtcgccatgcccgacggctcgctgcgggcggccctgcaacgcggcagcgag
ccctacctggtccaccccacccagttcccagcggtggtgaccgtgttcgcgatgaccatc
caccgcagccagggcagccagtacgacaccgtctccatcgtgctgcccgaacccgaatcc
accctgctcacccgcgaactgctctacaccgcgatcacccgggcgcgcgggcacgtccgc
gtcatcgggaccgaggagtcgatccgggcggcggtggggcggcgcgtgttgcgggcgagc
gggctgtcgcggcccgcgggcggatga

DBGET integrated database retrieval system