KEGG   Nocardia farcinica: nfa28660Help
Entry
nfa28660          CDS       T00207                                 

Definition
short chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nfa  Nocardia farcinica
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    nfa28660
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    nfa28660
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     nfa28660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(3050714..3051466)
Genome map
AA seq 250 aa AA seqDB search
MSGIDLTGRTALVTGAAGGIGAACARELARRGAAVTVADVDGPGAKAVADEIGGTAWEVD
LLDVAALEDLRLEVDILVNNAGVQTVSPITEFPPQRFRTMLALMVEAPFLLIRAALPHMY
AQRYGRIINISSVHGIRASAYKSAYVTAKHALEGLSKVTALEGGPHGVTSNCVNPGYVRT
PLVDKQIAEQAAAHGIPEQDVVEQVLLTESAVKRLVEPAEVASLVAWLTGDAAGMVTGAS
YTMDGGWSAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcatcgacctgaccgggcgcaccgcgctggtcaccggcgccgcgggcgggatc
ggcgcggcctgcgcccgcgaactcgcccggcgcggggccgcggtcaccgtcgccgatgtg
gacggaccgggcgccaaggccgtcgccgacgagatcggcggcaccgcatgggaagtcgat
ctgctcgacgtggcggcactcgaggacctgcgcctcgaggtcgacatcctggtcaacaac
gccggggtccagaccgtcagcccgatcaccgagttcccgccgcaacggttccgcaccatg
ctcgcgctcatggtggaggcgccgttcctgctgatccgcgcggcactgccgcacatgtac
gcgcaacggtacgggcggatcatcaacatctcctcggtacacgggatccgggcctcggcc
tacaaatccgcctatgtgaccgccaaacacgcgctggagggattgtcgaaggtgaccgcg
ctcgagggcggtccgcacggggtgaccagcaactgcgtcaaccccggatacgtgcgaacg
ccgttggtggacaagcagatcgccgagcaggccgccgcgcacggcattcccgaacaggac
gtggtggagcaggtcctgctcaccgagagcgcggtgaaacgcctcgtcgagcccgcggag
gtggcctcgctggtggcctggctcaccggcgacgcggcgggcatggtgaccggagccagt
tacacgatggacggcgggtggagcgcgcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system