KEGG   Nocardia farcinica: nfa29140Help
Entry
nfa29140          CDS       T00207                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nfa  Nocardia farcinica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    nfa29140
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     nfa29140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(3097171..3098736)
Genome map
AA seq 521 aa AA seqDB search
MAPHDTGTVAVRNILTRLCKRSGLSADRLRTTEIDVAPLLELPVIRRRAHRDRAAPEAVV
APVVRELAARLAPSDRFIVDAALALGLWRAEPPAGVDPDRLYAPDLGERRASLAEYWHTL
HAATDADPNPPELTVRSLRTNPERRAFTALAALLDADPGYGEPGYGDHGYDDTDDATARS
EAPAAHTAPLGRITVVGDAVIDHIYRTDRLPAEDAPAKGRFAEHLGGKGLNRAVAAARLG
FRVQLMAAVGDDPAGRRILRALRREDVGTDLVRIAAGEPTPVAALIVTATGAYGVIGRGD
DAVRLSAEDLTTPAALAALTDCDALLLTFEQPTPVLEQVLRLLRAGARTRPRLFVQPTPP
LEAPQYLYEFFDRIDYLIGTPGELAQLVGADPAAVGSETEEQVVHRLRALGVDCVCVVEG
LHCRVRSAALTLDVPRPAAAHLDESPGAPAAFVAALARRLAGHGWSAAEPADFAWATAAM
AATQSFGEIPHAMPAAAQIDRIAGFTTHAAAGAEYLTGGTG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcacgacaccggcaccgtcgccgtccgcaacatcctcacccggttgtgcaaa
cgttccggcctcagcgccgaccggttgcgcaccaccgaaatcgacgtcgcgccgctgctg
gaactgcccgtcatccgccgccgcgcccaccgcgaccgggccgcgcccgaggccgtcgtc
gcgccggtcgtgcgcgagctggccgcccgcctggcgcccagtgaccgcttcatcgtcgac
gccgccctcgcgctcggcctctggcgcgccgagccacccgccggggtcgaccccgaccgg
ctctacgcccccgacctcggcgaacggcgcgcgtccctggccgagtactggcacacattg
cacgccgccaccgacgccgacccgaatccgccggaactcaccgtgcgttcactgcgcacc
aaccccgaacgccgcgccttcaccgcgctggccgccctgctcgacgccgaccccggctac
ggcgaacccggctacggcgaccacggatacgacgacaccgatgacgcgacagcccggtcc
gaggcacccgccgcgcacaccgccccgctcggccgcatcaccgtggtcggcgacgcggtg
atcgaccacatctaccgcaccgatcgcctcccggccgaggacgcccccgccaagggccgc
ttcgccgaacatctcggcggcaagggcctcaatcgggcggtcgcggcggcccggctcggc
ttccgggtgcagctgatggccgcggtcggcgacgatccggccgggcggcgcatcctgcgc
gcgctgcgccgcgaggacgtcggcaccgacctggtgcgcatcgccgccggggagccgacc
ccggtggcggcactgatcgtgaccgccaccggcgcctacggcgtcatcggccgcggcgac
gacgcggtgcggctgagcgccgaggatctcaccacgcccgccgcgctggccgcgctcacc
gactgcgacgcgctgctgctgaccttcgagcaacccaccccggtgctcgaacaggtcctg
cggctgctgcgggccggagcccgcacccggccccggctgttcgtgcagcccaccccgccg
ctggaggcgccgcagtacctgtacgagttcttcgaccgcatcgactatctgatcggcacg
cccggtgaactggcccagctcgtcggcgccgaccccgccgcggtcggatcggagaccgag
gaacaggtggtgcaccggttgcgcgcgctcggcgtcgactgcgtgtgcgtggtcgagggg
ttgcactgccgggtgcgttcggccgcgctcaccctcgacgtgccgcgcccggccgccgcg
cacctggacgaatcccccggcgcgccggcggctttcgtcgccgcgctggcgcgccggctg
gccgggcacggctggagcgcggccgagcccgccgatttcgcgtgggcgaccgcggcgatg
gcggccacccagtccttcggtgagatcccgcacgccatgcccgcggccgcgcagatcgat
cggatcgcgggcttcaccacccatgccgcggccggcgccgaatacctcaccggcggcacc
ggctga

DBGET integrated database retrieval system