KEGG   Nocardia farcinica: nfa2950Help
Entry
nfa2950           CDS       T00207                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nfa  Nocardia farcinica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    nfa2950 (recR)
DNA repair and recombination proteins [BR:nfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      nfa2950 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
308598..309206
Genome map
AA seq 202 aa AA seqDB search
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLQVEPPEIDRLQAALQKVRDGVQFCVVCG
TVSDGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLARIGNQDDGVDVAEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaagggccggtacaggatctgatcgacgagttgggcaagctgcccggcgtcggt
cccaagagcgcgcagcgcatcgccttccacctgttgcaggtcgagccaccggagatcgac
cggttgcaggcggcattgcagaaggtccgtgacggcgtgcagttctgcgtggtgtgcggc
accgtctccgacggcgagctgtgccgcatctgcgccgatccgcgccgcgaccggaccatg
atctgcgtcgtcgaagagccgaaggacgtccaggccatcgagcggacgcgcgagttccgc
ggccgctaccacgtgctcggcggcgcgctcgacccgctcagcggtgtcggccccgatcag
ctgcgcatccgggagttgctggcgcgcatcggcaatcaggacgacggggtcgacgtcgcc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggccacggcgacctacctggtg
cgcatgttgcgcgatttcccaggactgaccgtgacccggctggcgtcgggcttgccgatg
ggcggtgacctggagttcgccgacgaactgacgctcggccgcgcgctgtccggacgtcgc
gcgctctag

DBGET integrated database retrieval system