KEGG   Nocardia farcinica: nfa33910Help
Entry
nfa33910          CDS       T00207                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nfa  Nocardia farcinica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nfa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(3592190..3592927)
Genome map
AA seq 245 aa AA seqDB search
MMDDHAVAADAAQHAGRALLAMRGQGGAAGDRHADRLLFERLRTLRPGDAILSEESPDER
VRLGRRRVWIIDPLDGTREYGEPSRTDWAVHVALAVDHVPTAGAVAMPAAGLVLHTGEPP
LPPPRRKGPLRIALSRSRPSELVNRVVTVLSADPVPMGSAGAKAMAVVQGAADAYVHSGG
QYEWDSCAPVAVAAAAGLHVSRLDGTALRYNRPDPYLPDLLICRPEFAETIIATVSAATG
RSASH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgatggacgaccacgctgtggccgcggacgccgcacaacacgccggtcgcgcgctgctc
gccatgcgcggacaagggggtgcggccggtgaccgccatgccgaccggctgctgttcgag
cggctgcgcacgctccgtccgggcgatgcgatcctctccgaggaaagccccgacgagcgt
gtgcggctgggtcggcgacgggtctggatcatcgatcccctcgacggcacccgcgagtac
ggggaaccgtcgcgaaccgattgggccgtgcacgtggcactcgcggtcgaccacgtgccc
acagccggcgccgtcgcaatgccggcggccgggctcgttctgcacaccggcgagccgccc
ctgccgccgcctcgccggaaggggccgctgcgcatcgcgctctcgcgcagccgcccatcc
gaactggtgaaccgtgtggtgacggtcttgtcggcggacccggtccccatggggtcggcc
ggcgcgaaggcgatggccgtcgtgcagggtgccgccgacgcctacgtgcactccggcggc
cagtacgaatgggactcctgcgcaccggtcgccgtcgccgcggcggccgggctgcatgtg
tcgcgtctcgacggcaccgcgctgcgctacaaccggcccgacccctacctgccggacctg
ttgatctgtcggcccgagttcgccgagaccatcatcgcgaccgtctcggccgccaccggc
cgaagcgcttcgcactga

DBGET integrated database retrieval system