KEGG   Nocardia farcinica: nfa35870Help
Entry
nfa35870          CDS       T00207                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nfa  Nocardia farcinica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa35870 (tpiA)
   01230 Biosynthesis of amino acids
    nfa35870 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    nfa35870 (tpiA)
   00051 Fructose and mannose metabolism
    nfa35870 (tpiA)
   00562 Inositol phosphate metabolism
    nfa35870 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    nfa35870 (tpiA)
Enzymes [BR:nfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     nfa35870 (tpiA)
Exosome [BR:nfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   nfa35870 (tpiA)
  Exosomal proteins of bladder cancer cells
   nfa35870 (tpiA)
  Exosomal proteins of melanoma cells
   nfa35870 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(3797286..3798071)
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFALPEKYFEKVDVAVIPPFVDIRSVQTLVEGD
KLLLTYGAQDVSVHESGAYTGEISASMLAKLGCTFVVVGHSERRQYHHEDDATVLGKAKK
ALEHGLTPIVCIGEGLNVREAGTHVEYNLEQLRGSLKGLSAEQIAKVVIAYEPVWAIGTG
KVASAADAQEVCGAIRAELAELAGPEVAAQVRVLYGGSVNAKNVGELVAQPDVDGALVGG
ASLKGDEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaaccgctcatcgccggcaactggaagatgaacctcaaccatctcgaggcc
atcgccctggtgcagaagatcgccttcgcgctgccggagaagtacttcgagaaggtcgac
gtcgcggtgatcccgccgttcgtggacatccgcagcgtgcagacgctggtggagggcgac
aagctgctgctcacctacggcgcgcaggacgtctcggtgcacgagtccggcgcctacacc
ggcgagatcagcgcgagcatgctcgccaagctgggctgcaccttcgtggtggtcgggcac
tccgagcggcgccagtaccaccacgaggacgacgccaccgtgctcggcaaggccaagaag
gccctcgagcacggcctcaccccgatcgtgtgcatcggtgaggggctcaacgtccgcgag
gcgggcacgcacgtggaatacaacctcgagcagctgcgcgggtcgctgaagggcctgtcc
gccgagcagatcgcgaaggtcgtcatcgcctacgagccggtctgggccatcggcaccggc
aaggtggcgagcgcggccgacgcgcaggaggtgtgcggcgccatccgcgccgagctggcc
gagctggccggacccgaggtggccgcgcaggtgcgggtgctctacggcggctcggtgaac
gccaagaacgtcggggaactggtcgcccagcccgatgtcgacggtgcgctggtcggcggg
gcctcgctcaagggtgacgagttcgccaccctgtccgcgatcgccgcgggcggcccgctg
ccctga

DBGET integrated database retrieval system