KEGG   Nocardia farcinica: nfa36460Help
Entry
nfa36460          CDS       T00207                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nfa  Nocardia farcinica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    nfa36460
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    nfa36460
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    nfa36460
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     nfa36460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
3859170..3860801
Genome map
AA seq 543 aa AA seqDB search
MAEKESFARRTLFKGGAVAAAVTAVSIAPGARAAGPVFRHGVASGDPLPTGVVIWTRVTV
SDEALPGSGAGEPAAVHWELARDERFTQVAASGTVVTTADIDHTVKIDVTGLAPARDYFY
RFTAFGQHSPTGRTRTAPAADASPERLRLGVVSCANWEAGWFGAYRHLATRDDLDAIVHL
GDYLYEYARGEYGTGLRAHEPAHEIRTLADYRVRHGQYKTDPDLAALHARLPFICTWDDH
ESADNSWSGGAGNHDPATEGDWADRRAASTRAYLEWMPVRAGGSGDEVRIYRRLRFGDLA
ELSMLDLRSYRDEEVVPGAQWRSVDDPERTITGREQLEWLTAGLTTAPVRWKLVGNSVMI
APLLFPPLEPATTEALTAVLGVPRAGAPVNADQWDGYTADRQRLFRAITENRVGDVVFLT
GDIHSSWAADLPVDAANYPGGPTAGAEFVVPSVTSASIGELLKAPPRTAAVPVEEAIKAA
NHHLRYVELESHGYGVLDVTADRTQMDWFYLLNVDDPASPVRHGASFAVPAGGRVQPQPG
PVA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaaggaatcgttcgcccgtcgcacgctgttcaagggcggcgcggtcgcagcc
gccgtcaccgcggtatcgatcgccccgggcgcgcgggccgcgggcccggtgttccggcac
ggggtcgcctcgggcgacccgctgcccaccggcgtcgtgatctggacccgcgtcaccgtc
tccgacgaggcgctgcccggttccggggccggggaacccgcggccgtgcactgggaactc
gcccgcgacgagcggttcacccaggtggcggcgtccggcaccgtcgtgacgaccgccgac
atcgaccacaccgtgaagatcgacgtcaccggcctggcgcccgcgcgcgactacttctac
cggttcaccgccttcggccagcactcccccaccggccgcacccgcaccgcccccgccgcc
gacgcctcccccgagcggctgcgtctcggcgtcgtgtcgtgcgcgaactgggaagcgggc
tggttcggcgcctaccggcacctggccacgcgcgacgacctcgacgcgatcgtccacctc
ggcgactacctctacgagtacgcccgcggcgaatacggcaccggcctgcgcgcccacgaa
cccgcgcacgagatccgcaccctggccgactaccgcgtccggcacggccagtacaagacc
gaccccgacctggccgccctgcacgcccggttgccgttcatctgcacctgggacgaccac
gaatccgccgacaactcctggtcgggcggcgccggcaaccacgacccggccaccgagggt
gactgggccgaccgccgcgccgcctccacccgcgcctatctggaatggatgccggtgcga
gcgggcgggtccggcgacgaggtgcggatctaccgccggctccggttcggcgacctggcc
gaactgtccatgctcgacctgcgcagctaccgcgacgaggaggtcgtccccggcgcgcag
tggcgctcggtggacgaccccgaacgcaccatcaccggccgcgagcaactcgaatggctc
accgcggggctcaccaccgcgccggtgcggtggaagctggtgggcaactcggtgatgatc
gcgcccctgctgttcccgccgctggaaccggccaccaccgaggcactcaccgctgtgctc
ggcgtgccgcgcgcgggcgcaccggtcaacgccgaccagtgggacggctacaccgccgac
cggcagcggctgttccgggccatcaccgagaacagggtcggcgacgtggtgttcctgacc
ggtgacatccactcctcctgggccgccgaccttcccgtggatgccgcgaactatccgggc
ggcccgaccgccggcgcggagttcgtcgtgccgtcggtcacctcggcgagcatcggcgaa
ctgctgaaggcaccgccccgcacggccgcggtaccggtggaggaggcgatcaaggccgcc
aaccaccacctgcgctacgtcgaactcgaatcgcacggctacggcgtgctcgacgtgacc
gcggaccgcacccagatggactggttctacctcctgaacgtcgacgacccggcgtccccg
gtccggcacggtgcctcgttcgcggtacccgcgggagggcgcgtccagcctcagccggga
ccggtcgcctga

DBGET integrated database retrieval system