KEGG   Nocardia farcinica: nfa36960Help
Entry
nfa36960          CDS       T00207                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nfa  Nocardia farcinica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    nfa36960 (ruvA)
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     nfa36960 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(3914268..3914873)
Genome map
AA seq 201 aa AA seqDB search
MIASVRGEVLEIALDHVVVEAAGVGYRLNATPSTLATLTRGAEARLYTAMIVREDSMTLY
GFADTEARDLFGLLQTVSGVGPRLAMAVLAVLEPEALRKALAESNVAALTRVPGIGKRGA
ERMVVELRDKVNLVPVQAGPPGSTPAVAATPVREQVVEALTGLGFPLKQAEQALDTVLAE
QPAADTSTALRAALSLLGKNR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgtcggtacgcggcgaggtgctcgagatcgcgctggaccacgtggtggtggag
gcggcgggcgtcggctaccggctcaacgccaccccgtcgacgctggccaccctcacccgc
ggcgcggaagcgcggctctacacggcgatgatcgtccgcgaggactcgatgaccctgtac
ggcttcgccgacaccgaggcgcgcgacctgttcggcctgttgcagaccgtctccggtgtc
gggccgcgcctggcgatggcggtgctggccgtgctcgagcccgaggcgctgcgcaaggcc
ctggccgagagcaacgtcgcggcgctcacccgggtgcccggcatcggcaaacgcggcgcc
gaacgcatggtggtggagctgcgggacaaggtgaacctggtgccggtgcaggcgggcccg
cccggcagcactcccgccgtcgccgccaccccggtgcgcgagcaggtggtcgaagcgctc
accgggctcgggttcccgctcaaacaggccgaacaggcgctcgacacggtgttggccgag
cagcccgccgccgacacctccaccgcgctgcgcgccgcgctgtcgctgctgggcaagaac
cggtag

DBGET integrated database retrieval system