KEGG   Nocardia farcinica: nfa4000Help
Entry
nfa4000           CDS       T00207                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nfa  Nocardia farcinica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
420849..421739
Genome map
AA seq 296 aa AA seqDB search
MREAAVSATNVTARGGRRCVVMGVVNVTSDSFSDGGRYLDPDRAIAHGVELYEAGADIID
VGGESTRPGAVRVDPATEAARVTPVIQGLVAAGVPTSVDTMRAAVAEAALAAGVSVINDV
SGGRADADMVKVVAEADVPWILMHWRAAADYRHTGPADHYEDVVAEVRTELDAQVELAVR
SGVDPGRLILDPGLGFAKNAAHNWALLAALPEFVEAGLPVLIGASRKRFLGALLADANGP
RPPDGREVATATVSALAALYGAWGVRVHDVRSSLDAIAVVDAWQRAQPPKVRGAVG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgagggaggccgcggtgtccgccacgaatgtcaccgcgcgcggcgggcgccgctgtgtc
gtgatgggcgtggtgaacgtgaccagcgactccttctccgacggcggccgctacctcgac
ccggaccgtgccatcgcgcacggcgtcgagttgtacgaggcgggcgcggacatcatcgac
gtcggcggggagtcgacccggcccggcgcggtccgggtcgatccggcgaccgaggccgcg
cgggtgaccccggtgatccagggcctggtcgccgcgggggtgcccaccagcgtcgacacc
atgcgcgccgcggtcgccgaggccgcgctcgcggcgggtgtctcggtgatcaacgacgtt
tccggcggtcgcgccgacgccgacatggtgaaggtcgtggccgaggccgacgtgccgtgg
atcctgatgcactggcgggccgccgccgactaccggcacaccgggcccgccgaccactac
gaggacgtcgtcgccgaggtgcgcaccgaactcgacgcgcaggtcgagctggcggtgcgt
tccggcgtggatccgggcaggctgatcctcgatcccggcctcggcttcgccaagaacgcc
gcgcacaactgggcgctgctggccgcgctgccggagttcgtcgaggcggggctgccggtc
ttgatcggcgcctcccgcaagcgtttcctcggcgccctgctcgccgacgcgaacggaccc
cgcccgcccgacgggcgcgaggtcgccaccgccacggtctccgcgctcgccgcgctgtac
ggcgcgtggggtgtgcgggtgcacgacgtgcggtcctcactggatgcgatcgccgtcgtc
gatgcctggcagcgggcgcagccgccgaaggtccgaggagccgtgggatga

DBGET integrated database retrieval system