KEGG   Nocardia farcinica: nfa4020Help
Entry
nfa4020           CDS       T00207                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nfa  Nocardia farcinica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    nfa4020 (folK)
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     nfa4020 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
422161..422706
Genome map
AA seq 181 aa AA seqDB search
MSRAVLSIGSNLGDRLGYLRSVVDAVADRLVAVSSVYTTAPWGGVEQDDFLNAILVVDDP
DRGCRDWLALGQRLERAAHRTRAVRWGARTLDVDVIWCADADGPVVSADPELTVPHPRAH
ERAFVLIPWLEAEPHARLAVGDVERSVRDWLAALDPAERDGVRRTDLSLRASAVPGEGLP
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagggcggtgttgtcgatcggttcgaatctgggcgatcggctcgggtacctgcgc
agcgtggtggacgccgtcgccgaccggctggtcgcggtgtcctcggtctacacgacggca
ccgtggggcggtgtcgagcaggacgatttcctcaacgcgatcctggtcgtcgacgatccg
gatcgcggctgccgcgactggctggcgctcgggcagcggctggagcgggccgcccaccgg
acgcgggcggtgcggtggggtgcgcgcacgctcgatgtcgacgtgatctggtgcgcggac
gccgacggcccggtggtcagcgccgatccggagctgacggtgccgcacccgcgcgcgcac
gagcgggcgttcgtgctgatcccctggctggaggccgagccgcacgcgcggctggccgtc
ggcgacgtcgagcggtcggtgcgcgactggctggccgcgctcgacccggccgaacgcgac
ggcgtgcggcgcaccgatctgtccctgcgcgcctcggcggttccgggggaagggttgccc
tcgtga

DBGET integrated database retrieval system