KEGG   Nocardia farcinica: nfa40830Help
Entry
nfa40830          CDS       T00207                                 

Definition
magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nfa  Nocardia farcinica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nfa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(4233874..4235787)
Genome map
AA seq 637 aa AA seqDB search
MTEEAGFPFSAVVGQERLQLALILCAVHPGIGGVLVRGEKGTAKSTVVRALAQLLPPVVD
ETGARPARLVELPVGATEDRVVGSLDLERVLRDGEQAFRPGLLAAAHHGVLYVDEVNLLH
DHLVDVLLDAAAMGRVHVERDGVSHSHPARFVLVGTMNPEEGELRPQLLDRFGLTVDVAA
SRDVDVRMTVVRRRLDYEADPAGFAARYAAADREIADRILAARERVACVELDDTELRRIA
ALCAAFDVDGMRADLVVARTATAHAAWRGADAVEAEDVRVAAELALPHRRRRDPFDEPGI
SEDQLDQAMRDAAEQAEPPATDEPDQPPRSADRGEDPGDGPDDPGTPPEGGPGGGQAPEG
RTGTPAPGAAKPPRWEVPGVGEGAPGRRSRAQTRTGRVVRSTTEPGTGLHLLGTVFAAAP
HQRTRGRLAGPLALAPEDLRGAYREGREGNLVVFVVDASGSMAARDRLSAVTGAIVTLLR
DAYQRRDKVAVVSVRGATADLVLPPTSSVDIAVRRLAGLRTGGKTPLAAGLLRAREIVAR
ERVRDPRRRPMLVLLTDGRATGGADPVGRAKTAAGLLARDGVTAMVVDCERGMVRLGLAA
DLARALGGTLVRLGELTGAAVADVVRAADPARSPRAA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaggaggcggggtttccgttctcggccgtggtcgggcaggagcggctgcagttg
gcgctgatcctgtgtgcggtgcatccggggatcggcggggtgttggtgcgcggcgagaag
ggcaccgcgaagtcgacggtggtgcgggcgctggcgcagctgttgccgccggtggtggac
gagaccggggcgcggcccgcgcgactggtggagctgccggtcggcgcgaccgaggaccgg
gtggtcggctcactggatctggaacgggtgctgcgcgacggcgaacaggcgttccggccc
gggctgttggccgccgcccaccacggcgtgctctacgtcgacgaggtcaatctgctgcac
gaccacctggtggacgtgctgctcgacgcggccgcgatgggccgggtgcacgtcgaacgc
gacggcgtctcgcattcgcatccggcgcgcttcgtgctggtcggcaccatgaacccggag
gagggcgagctgcgtccgcagctgctggaccgtttcggcctcaccgtcgacgtggccgcc
tcccgtgacgtggacgtccgcatgaccgtggtgcggcgcaggctcgactacgaggccgac
ccggccgggttcgccgcgcgctacgccgccgccgaccgggagatcgccgaccgcattctc
gccgctcgcgagcgggtcgcctgcgtcgaactcgacgacaccgaattgcgccggatcgcc
gccctgtgcgcggctttcgacgtcgacggcatgcgcgcggacctggtggtcgcgcgcacg
gccaccgcgcacgccgcgtggcgtggggccgacgcggtcgaggccgaggacgtgcgggtg
gcggcggaactggcgctgccgcatcgccgtcgccgtgaccccttcgacgagccgggcatc
agcgaggaccaactcgaccaggccatgcgcgacgcggccgagcaggccgaaccgcctgcc
acggacgagccggaccagccgccgcgctccgcggaccgcggcgaggatcccggcgacggc
cccgacgaccccggcacaccgcccgagggcgggccgggtggcgggcaggcccccgaaggg
cggaccggcaccccggcgcccggcgccgcgaaaccgccgcgctgggaggtgcccggcgtc
ggcgagggcgcccccggccgccgttcccgcgcccagacccgcaccggccgggtggtccgc
tccaccaccgagccgggcaccggcctgcacctgctcggcaccgtcttcgccgcggcgccg
caccagcgcacgcgcggccgcctcgccgggccgctcgcgctcgccccggaagatctgcgc
ggcgcgtatcgcgaaggccgcgaaggcaatctggtcgtgttcgtggtcgatgcctccggc
tcgatggccgccagggaccggctgtcggcggtgaccggcgcgatcgtcaccttgctgcgc
gacgcctatcagcgccgcgacaaggtggcggtggtgagcgtgcgcggcgcgaccgcggac
ctggtgctgccgccgacctcctcggtggacatcgcggtccgcaggctcgcgggcctgcgc
accggcggcaagaccccgctggcggcgggtctgctgcgggcgcgcgagatcgtcgcccgc
gagcgcgtccgcgacccgcgcaggcggccgatgctggtgttgctcaccgacggccgcgcc
accggcggcgccgatccggtgggccgggcgaagacggcggcggggctgctggcccgcgac
ggcgtcaccgcgatggtggtcgactgcgagcgcggcatggtccgcctcgggctggccgcc
gacctggcgcgggcgctgggcggcacgctggtgcggctcggcgagctgaccggagcggcg
gtcgccgacgtcgtgcgcgcggccgaccccgcccgatcgccgcgcgccgcctga

DBGET integrated database retrieval system