KEGG   Nocardia farcinica: nfa41920Help
Entry
nfa41920          CDS       T00207                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
nfa  Nocardia farcinica
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:nfa00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(4340784..4341215)
Genome map
AA seq 143 aa AA seqDB search
MFASIGSRPRRRREECPMTDPDAVVRALCQAWSTPDPDAIAAYFAEDAVYHNIPMDPVVG
RTAIREFVAGFLTTFEAIDFEIHHQVAADGVVMNERTDTMRGKDGRATPLPVMGVFEVRD
GLITAWRDYFDMAAVTAAFAPPE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgcttcaatcggaagccgtccccgccgccgacgagaagagtgccccatgaccgac
cccgacgccgtcgtccgcgccctgtgccaggcctggtcgacccccgaccccgacgcgatc
gcggcctacttcgccgaggacgccgtgtaccacaacatcccgatggatccggtcgtcggc
cgcaccgccatccgggagttcgtcgcggggttcctgaccaccttcgaggccatcgatttc
gagatccaccaccaggtggccgccgacggcgtggtgatgaacgagcgcaccgacaccatg
cgcggcaaggacggccgagccacgccgctgccggtcatgggtgtgttcgaggtgcgcgac
ggcctgatcacggcctggcgcgactacttcgacatggcggccgtgaccgccgcgttcgcg
ccaccggagtga

DBGET integrated database retrieval system