KEGG   Nocardia farcinica: nfa42410Help
Entry
nfa42410          CDS       T00207                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nfa  Nocardia farcinica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa42410 (pfkA)
   01230 Biosynthesis of amino acids
    nfa42410 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    nfa42410 (pfkA)
   00030 Pentose phosphate pathway
    nfa42410 (pfkA)
   00051 Fructose and mannose metabolism
    nfa42410 (pfkA)
   00052 Galactose metabolism
    nfa42410 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    nfa42410 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    nfa42410 (pfkA)
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     nfa42410 (pfkA)
Protein phosphatases and associated proteins [BR:nfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     nfa42410 (pfkA)
Messenger RNA biogenesis [BR:nfa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     nfa42410 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(4390165..4391199)
Genome map
AA seq 344 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTANGRYGDAIVGFQDGWRGLLEDRKINILNDDRTDR
LLNKGGTMLGTARTNPDVLRAGLGKIKQTLDDNGIEALIPIGGEGTLTAASWLSDEGVPV
VGVPKTIDNDIDCTDVTFGHDTALSIATEAIDRLHTTAESHQRVMLVEVMGRHAGWIAVN
SGMAAGAHLTLVPEEPFDVDEVCTMIKRRFQRGDKHFICVVAEGSHPAPDSGFTLREGGV
DEFGHERFTGVAQQLGTEIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAV
HAGHFGQMVALHGTAIELVPLAEATKQLKRVPTERYREAQAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagtcttgaccggaggcggggactgtccaggactgaacgcggtcatccgc
gctgtcgttcgtaccgcgaacggccgctacggtgacgcgatcgtgggattccaggacggc
tggcgcggcctattggaagaccgcaagatcaacatcctcaacgacgaccgcaccgaccgg
ctgctcaacaagggcggcaccatgctcggcaccgcgcgcaccaaccccgacgtgctgcgc
gccgggctcggcaagatcaaacagacgctcgacgacaacggcatcgaggcactcatcccg
atcggcggcgagggcaccctcaccgcggccagctggctctccgacgagggggtgccggtg
gtcggcgtccccaagaccatcgacaacgacatcgactgcaccgatgtcaccttcggccac
gacaccgccctgagcatcgccaccgaggccatcgaccggctgcacaccaccgccgaatcg
caccagcgcgtgatgctggtcgaggtgatgggcaggcacgcgggctggatcgcggtcaac
tcgggcatggccgcgggcgcccacctcaccctggtgccggaggaacccttcgacgtcgac
gaggtgtgcacgatgatcaagcggcgcttccagcgcggcgacaagcatttcatctgcgtg
gtggccgagggctcgcatcccgcgcccgattccgggttcaccctgcgcgagggtggtgtc
gacgagttcggccacgagcggttcaccggcgtggcgcaacagctgggcaccgagatcgag
cgccgcatcggcaaggaggtgcgcaccaccgtcctcggtcacgtgcagcgcggcggcagc
cccaccccctacgaccgggtactggcgacccgcttcggcctgcacgccgccgaggccgtg
cacgccggacatttcggccagatggtcgcgctgcacggcaccgccatcgaactggtgccg
ctggccgaggcgaccaagcagctcaagcgcgtgcccaccgagcggtaccgggaggcgcag
gcgttcttcgggtga

DBGET integrated database retrieval system