KEGG   Nocardia farcinica: nfa42810Help
Entry
nfa42810          CDS       T00207                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nfa  Nocardia farcinica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    nfa42810
Enzymes [BR:nfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     nfa42810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
4433564..4435174
Genome map
AA seq 536 aa AA seqDB search
MNSVSSQQVPGQFTLVLHSHLPWLAHHGRWPVGEEWLYQSWAASYLPVVEVLRTLAAEGR
SHLLTLGITPVLAAQLDDPHCLAGMHHWLGNWQLRADEASAAGNVALGRHEHRLATAALA
EFEQHWRHGAAPVWRSLVDAEVVELLGGPLAHPFQPLLHPRLRAFQLSEGLADARHRWGT
RPTGIWAPECGYTPGMERGYAAAGVTHFLVDGPALRGDSSLGRPVHDSDVVAFGRDLHVS
YRVWSPKSGYPGHAAYRDFHHYDHATGLKPSRVTGKTVAGPDKAPYDPELAAAAVAGDVE
DFVRTVRARLIAESDRIGRPALVVAAFDTELFGHWWHEGPQWLAQVLRALPEAGVTVGTL
ADARARGFVGEPVPLADSSWGSGKDWRVWAGDQVRDLVELNDEVVGLALDTVDKMRAADP
GAPALRDPVADQLLREAILTVSSDWAFMVSKDSAAGYARDRAHQHAHAVREIAAAVGAGQ
VAKARQLAARWSAADGFFPGVDARRLPDADAPPVPSADAPRPPAAGTPGPASEGLA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccgtgtcgtcgcaacaggttccgggccagttcacgctggtcctgcattcccac
ctgccgtggctggcccaccacggacgctggccggtgggcgaggaatggctctaccagtcc
tgggccgcctcctaccttcccgtggtcgaggtactgagaacgcttgccgcggaaggccgt
tcgcacctactgacgctcgggatcaccccggtgctcgcggcccagctcgacgatccgcac
tgcctggccggcatgcaccactggctgggcaactggcagctgcgcgccgacgaggcgtcg
gcggcgggcaacgtcgcgctggggcggcacgagcaccgactggccaccgcggcgctggcc
gaattcgaacagcactggcgccacggcgcggccccggtgtggcgcagcctggtcgacgcc
gaggtggtcgagctgctcggcggcccgctggcgcacccgttccagccgctgctgcatccg
cggttgcgcgccttccagctgagcgagggactagccgacgcccggcaccgctggggcacc
cggcccaccggcatctgggcgcccgaatgcggctacacccccggtatggaacgcggctac
gccgcggcgggcgtgacgcatttcctggtcgacggacccgcgctgcggggcgacagcagc
ctcggcaggcccgtgcacgactcggatgtggtggcgttcgggcgcgatctgcacgtcagc
taccgggtgtggtcgcccaaatccggctatcccggccacgccgcctaccgtgattttcat
cactacgaccacgcgacgggtctcaagccgtcccgggtcaccggcaagaccgtcgccggg
cccgacaaggccccctacgatcccgagctggcggccgcggcggtcgccggtgacgtcgag
gacttcgtgcggacggtgcgggcgcggctgatcgcggagtccgaccgcatcggccgtccc
gcgctggtggtggccgcgttcgacaccgaactcttcggccactggtggcacgagggaccg
cagtggctggcgcaggtgctgcgggcgctgcccgaggccggggtcaccgtcggcaccctc
gccgacgcgcgggcccgcggtttcgtcggcgaaccggtgccgctggccgattcctcgtgg
ggctcgggcaaggactggcgggtgtgggccggtgatcaggtgcgcgatctggtcgagctc
aacgacgaggtcgtcgggctggccctggacaccgtcgacaagatgcgcgcggccgacccg
ggcgccccggcactgcgcgacccggtggccgatcagctgctgcgcgaggcgatcctgacc
gtctcgagcgactgggcgttcatggtcagcaaggactccgccgcgggctacgcgcgcgac
cgggcccaccagcacgcgcatgccgtccgcgagatcgcggccgcggtgggggcgggtcag
gtcgccaaagcgcgccagttggcggcaagatggagcgcggccgacggattcttccccgga
gtggatgcgcgacggctgcccgacgccgacgcgccgcccgtgcccagcgctgacgcgccc
cgtccacccgccgccgggacgccgggcccagcctcagaaggacttgcatga

DBGET integrated database retrieval system