KEGG   Nocardia farcinica: nfa42820Help
Entry
nfa42820          CDS       T00207                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
nfa  Nocardia farcinica
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    nfa42820
Enzymes [BR:nfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     nfa42820
Glycosyltransferases [BR:nfa01003]
 Polysaccharide
  Storage polysaccharide
   nfa42820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
4435171..4436433
Genome map
AA seq 420 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLAVELAAAGHEVVVLSRRPTGTDPTTHPTHSFIEDG
VLVVAVAEDPPCFDFGEDMLAWTLAMGHAMVRAGVGLGKPGIGEGWTPDVVHAHDWLVAH
PAIALAEYYDVPLVSTIHATEAGRHSGWVAGRVNKQVHSVEWWLANESDALITCSSSMQD
EVERLYGPERVPITVIRNGIDVGAWTFRPRAPRTGPPRLLYVGRLEYEKGVQDAIAALPR
IRRAHPGTTLTVAGVGTQFEWLRERARVHRVARAVTFTGQLGHAELLGWLHGADAIVLPS
RYEPFGIVALEAAAAGTPLVTSTAGGLGEAVIDGVTGASFEPADVDGLVEAVRATLDDPA
AAQQRAYAARERLTADFAWDVVAAETAQVYSSAKRRVRNPLGRPVIVERPLPERDPNNPV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttgatggtgtcgtgggagtacccaccggtggtggtcggcgggctcggcagg
catgtgcaccacctggcggtcgagctggccgcggccggacacgaggtggtcgtgctctcg
cgcagacccaccggcaccgaccccaccacccacccgacgcactcgttcatcgaggacggc
gtgctcgtggtcgccgtcgccgaggacccgccgtgcttcgacttcggcgaggacatgctg
gcctggaccctggcgatggggcacgccatggtgcgcgcgggtgtcggtctcggcaagccc
ggcatcggtgagggctggacgcccgacgtggtgcacgcgcacgactggctggtcgcgcac
ccggcgatcgcgctggccgagtactacgacgtgccattggtctccaccatccacgccacc
gaggcgggcaggcacagcggctgggtggccggccgggtcaacaagcaggtgcactcggtg
gagtggtggctggccaacgaatccgacgccctcatcacctgctcgtcgtcgatgcaggac
gaggtggaacggctctacgggcccgagcgcgtgccgatcacggtgatccgcaacggcatc
gacgtgggcgcgtggaccttccggccgcgcgcgccgcgcaccggcccgccgcggctgctc
tacgtcggcaggctcgaatacgagaagggcgtgcaggacgcgatcgccgcgctgccgcgc
atccggcgcgcgcacccgggcaccacgctcaccgtcgccggggtcggcacccagttcgaa
tggctgcgcgaacgcgcccgcgtgcaccgggtggcacgggcggtgaccttcaccgggcag
ctcggccacgcggaactgctcggctggctgcacggcgcggacgcgatcgtgctgcccagc
cgctacgaaccgttcggcatcgtggcgctggaagcggccgcggcgggcaccccactggtc
acctcgaccgcgggcgggctcggcgaggccgtgatcgacggtgtcaccggggcctcgttc
gaaccggccgatgtggacgggctggtggaggcggtgcgcgccaccctcgacgaccccgcc
gccgcgcaacagcgcgcctacgccgcccgcgaacgcctcaccgccgacttcgcctgggac
gtggtggccgccgagaccgcgcaggtgtactcctcggccaagcggcgggtgcgcaatccg
ctgggccgcccggtcatcgtggaacggccgctgccggaacgggatccgaacaacccggtg
tga

DBGET integrated database retrieval system