KEGG   Nocardia farcinica: nfa43870Help
Entry
nfa43870          CDS       T00207                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nfa  Nocardia farcinica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    nfa43870
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    nfa43870
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    nfa43870
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     nfa43870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
4545855..4547522
Genome map
AA seq 555 aa AA seqDB search
MWGMALPRRNLPRRNLPRRNLLRVAAAGSAAVLVGTAAASSGRFRVPRWSDDPFTLGVAS
GDPAPDGVVLWTRLAPDPFAPDGHGGMMNAPVSVDYEVAHDEQFRSVVQRGTAVATRELA
HSVHPEVRGLEPDRWYFYRFRAGSVISPVGRTRTAPAPGQAVERLRFAYASCQSWSSGYY
TAYEHLRAEDVELVVHLGDYIYESSWRHGRLEDPRTLERGESVDLPGYRLRYAQYKAEQP
LRDAHAAFPWIVTFDDHEVDNNWAADHPGLGVDIYRLPPLFRGRKAAAFQAMYEHQPLRL
AQLPDGPSMLLHRRFGWGDLAELTMLDTRQYRDVQVCSENVTADCPERFATDRTILGARQ
RDWLLAGLVSSPARWQILGNQVGMSQMDVDPGPGLTVSTDSWDGYVADRNLILGTAADRG
VRNLVVITGDRHQNHAADLRRDHADPQSPVVAAEFTGTSITTGGDGADVNDTGRRLLAAN
PDLKFFNSQRGYVRVELDHRVWRNDFRVVPFVQRRGAPVHTRSTWVVEDGIPGVAEAARP
AAPTTGLSAAPDGGG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgtggggtatggctctgccccgccggaacctgccccgccggaacctgccccgccggaac
ctgctccgcgtcgccgccgccgggtcggccgccgtgctggtgggcaccgcggcggcgagc
agcggccggttccgggtgccgcgctggtcggacgacccgttcacgctgggtgtcgcctcc
ggtgatccggcccccgacggggtggtgttgtggacgcggctggcgccggaccccttcgcg
cccgacgggcacggcgggatgatgaacgcgccggtctcggtggactacgaggtcgcccac
gacgagcagttccgctcggtggtgcaacgcggcaccgcggtggcgacccgggagctggcc
cattcggtgcatcccgaggtgcgcgggctcgagcccgaccgctggtatttctaccggttc
cgggcgggttcggtgatctctccggtgggccgcacccgcaccgcgcccgcccccggccag
gccgtcgagcgcctgcgtttcgcctacgcgtcctgtcagtcgtggagttcggggtattac
accgcctacgagcatctgcgcgccgaggatgtcgagctggtcgtgcatctgggtgactac
atctacgagagcagctggcgccacggcaggctggaggatccgcgcaccctcgaacgcggc
gagtcggtggatctgccggggtatcggttgcgctatgcccagtacaaggccgagcagccg
ctgcgtgacgcgcatgccgccttcccgtggatcgtcaccttcgacgaccacgaggtcgac
aacaactgggccgccgaccatcccggcctcggcgtggacatctaccggttgccgccgttg
ttccgcgggcgcaaggcggccgcgttccaggccatgtacgagcatcagccgctgcggttg
gcgcagctgccggacggtccgtcgatgctgctgcatcgccggttcggctggggtgatctg
gccgaactaaccatgctcgacacccgtcagtaccgtgacgtgcaggtctgcagcgagaac
gtgaccgccgactgccccgagcgcttcgccaccgatcgcaccattctcggtgcgcggcaa
cgggattggctgctggcggggttggtcagctcgcccgcccgctggcagatcctcggcaac
caggtggggatgagccagatggacgtggatccggggccggggctgacggtgtccaccgac
tcctgggacggctacgtcgccgaccgcaacctgatcctggggaccgccgccgatcgcggg
gtgcgcaacctggtcgtcatcaccggcgaccggcaccagaaccatgccgccgacctgcgc
cgcgatcacgccgacccgcagtcgccggtggtggccgccgaattcaccggcacctcgatc
accaccgggggcgacggcgccgacgtcaacgacaccggccgtcggctgctggcggccaac
ccggatctgaagttcttcaactcccagcgcggttatgtccgtgtcgaactcgaccaccgg
gtgtggcgcaacgacttccgggtggtgccgttcgtccagcgccgtggcgcgccggtgcac
acgcggtcgacctgggtggtggaggacggcatccccggcgtcgccgaggcggctcgcccg
gccgcgcccaccaccggattgtccgccgcgccggacggcggcggctga

DBGET integrated database retrieval system