KEGG   Nocardia farcinica: nfa4660Help
Entry
nfa4660           CDS       T00207                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nfa  Nocardia farcinica
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    nfa4660
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    nfa4660
   00650 Butanoate metabolism
    nfa4660
  Amino acid metabolism
   00360 Phenylalanine metabolism
    nfa4660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    nfa4660
   00622 Xylene degradation
    nfa4660
   00621 Dioxin degradation
    nfa4660
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     nfa4660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
482652..483560
Genome map
AA seq 302 aa AA seqDB search
MSNGTVTAAIVGSGNISTDLLYKLLRSQAIEPRWMIGIDPESEGLKRARGLGLETSHEGV
DWLLAQSELPDMIFEATSAYVHRAAAPRYAEAGIRAVDLTPAAVGPAVVPPVNLGANLDA
PNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGVE
TIGGAQRGKAIIILNPAEPPMIMRDTIFCAIPEDADTDAIADSIHRMVADIQQYVPGYRL
LNEPQFDEPSVVSGGLAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATKVGEVIAGQITSA
RV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaacgggaccgtcaccgccgcgatcgtcgggtccggcaacatcagtaccgatctg
ctctacaaactgctgcgttcgcaggccatcgagccgcgctggatgatcggcatcgacccg
gagagcgagggcttgaagcgcgcccgcggcctggggttggagacctcgcacgagggcgtg
gactggctgctggcgcagtcggagctgcccgacatgatcttcgaggccacctcggcctac
gtgcaccgcgccgccgccccccgctacgccgaggcgggcatccgcgcggtcgacctgacc
ccggccgccgtcggccctgcggtggtgccgccggtgaacctgggcgcgaacctggacgcc
cccaacgtcaacatgatcacctgcggcgggcaggccaccatcccgatcgtggccgccgtc
tcgcgcgtcgtgccggtgccctacgccgagatcgtcgcctcggtgtcgtcggtctcggcc
gggccgggcacccgtgccaacatcgacgagttcaccaagaccaccagccggggcgtggag
accatcggcggtgcgcagcgcggcaaggcgatcatcatcctgaacccggccgagccgccg
atgatcatgcgcgacaccatcttctgcgcgatccccgaggacgccgacaccgacgcgatc
gccgactccatccatcggatggtcgccgacatccagcagtacgtgcccggctaccggctg
ctcaacgagccgcagttcgacgagccgtcggtggtgtccggcggcttggcgaaggtgtcg
gtgttcgtcgaggtggaaggcgcgggcgacttcctgccgccgtacgcgggcaacctcgac
atcatgaccgcggcagcgaccaaggtcggcgaggtcatcgccggccagatcacctcggcc
cgggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system