KEGG   Nocardia farcinica: nfa4660Help
Entry
nfa4660           CDS       T00207                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nfa  Nocardia farcinica
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nfa00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nfa00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:nfa00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:nfa00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:nfa00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
482652..483560
Genome map
AA seq 302 aa AA seqDB search
MSNGTVTAAIVGSGNISTDLLYKLLRSQAIEPRWMIGIDPESEGLKRARGLGLETSHEGV
DWLLAQSELPDMIFEATSAYVHRAAAPRYAEAGIRAVDLTPAAVGPAVVPPVNLGANLDA
PNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGVE
TIGGAQRGKAIIILNPAEPPMIMRDTIFCAIPEDADTDAIADSIHRMVADIQQYVPGYRL
LNEPQFDEPSVVSGGLAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATKVGEVIAGQITSA
RV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaacgggaccgtcaccgccgcgatcgtcgggtccggcaacatcagtaccgatctg
ctctacaaactgctgcgttcgcaggccatcgagccgcgctggatgatcggcatcgacccg
gagagcgagggcttgaagcgcgcccgcggcctggggttggagacctcgcacgagggcgtg
gactggctgctggcgcagtcggagctgcccgacatgatcttcgaggccacctcggcctac
gtgcaccgcgccgccgccccccgctacgccgaggcgggcatccgcgcggtcgacctgacc
ccggccgccgtcggccctgcggtggtgccgccggtgaacctgggcgcgaacctggacgcc
cccaacgtcaacatgatcacctgcggcgggcaggccaccatcccgatcgtggccgccgtc
tcgcgcgtcgtgccggtgccctacgccgagatcgtcgcctcggtgtcgtcggtctcggcc
gggccgggcacccgtgccaacatcgacgagttcaccaagaccaccagccggggcgtggag
accatcggcggtgcgcagcgcggcaaggcgatcatcatcctgaacccggccgagccgccg
atgatcatgcgcgacaccatcttctgcgcgatccccgaggacgccgacaccgacgcgatc
gccgactccatccatcggatggtcgccgacatccagcagtacgtgcccggctaccggctg
ctcaacgagccgcagttcgacgagccgtcggtggtgtccggcggcttggcgaaggtgtcg
gtgttcgtcgaggtggaaggcgcgggcgacttcctgccgccgtacgcgggcaacctcgac
atcatgaccgcggcagcgaccaaggtcggcgaggtcatcgccggccagatcacctcggcc
cgggtgtaa

DBGET integrated database retrieval system